Dbfetch

Dbfetch

LOCUS       XM_024679297             671 bp    mRNA    linear   PLN 12-APR-2018
DEFINITION  PREDICTED: Selaginella moellendorffii ubiquitin-conjugating enzyme
            E2 5 (LOC9658363), transcript variant X3, mRNA.
ACCESSION   XM_024679297
VERSION     XM_024679297.1
DBLINK      BioProject: PRJNA50439
KEYWORDS    RefSeq.
SOURCE      Selaginella moellendorffii
  ORGANISM  Selaginella moellendorffii
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003314285.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Selaginella moellendorffii
                                           Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..671
                     /organism="Selaginella moellendorffii"
                     /mol_type="mRNA"
                     /db_xref="taxon:88036"
                     /chromosome="Unknown"
     gene            1..671
                     /gene="LOC9658363"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 ESTs, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     9 samples with support for all annotated introns"
                     /db_xref="GeneID:9658363"
     CDS             36..584
                     /gene="LOC9658363"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 5 isoform X3"
                     /protein_id="XP_024535065.1"
                     /db_xref="GeneID:9658363"
                     /translation="MSSPSRRREMDVMKLMMSDYKVEMLNDGMNEFIVDFQGPADSPY
                     ESGVWKVRVELPDSYPYKSPSIGFVNKIFHPNVDDSGSVCLDVINHTWSPMFDLVNVF
                     ESFLPQLLLYPNPSDPLNGEAGSLMMRDKERYEQKVKEYCERYAKPKDAQTAVEESSD
                     GEISDDSYTSSEDDTLGWQADP"
ORIGIN      
        1 tttggggttg ctcattcatt tagggttttt ggacaatgtc gtctccaagc cggcgccggg
       61 agatggatgt gatgaagctc atgatgagcg attacaaggt ggaaatgctc aacgatggca
      121 tgaacgagtt cattgtggat tttcaggggc cagcagatag tccttatgag agtggagtgt
      181 ggaaggtccg cgttgagctt cccgactctt atccctacaa atcgccctcc attggattcg
      241 tgaacaagat cttccatccg aatgtcgacg actcgggatc tgtttgcctg gatgtgatca
      301 atcacacttg gagccccatg tttgacctcg tcaatgtttt cgagtcattc cttccgcagc
      361 tgctgctgta tccaaatcca agtgaccctt tgaatggcga ggccgggtct ctgatgatga
      421 gggacaaaga aaggtacgag caaaaggtga aagagtactg cgagagatat gccaagccca
      481 aagatgcgca aaccgctgtg gaagagagca gtgacgggga gatcagtgac gacagctaca
      541 cgtcgagcga agacgacacc ctgggctggc aagcagaccc gtgaggaaag aagacgagaa
      601 aacgtctgat ttgtaaatag ccagattgta cataaattgc caaatgtaag tagctccaac
      661 gtatccatct a
//