› › High-potential iron-sulfur protein

High-potential iron-sulfur protein in PDB entry 5d8v, assembly 1, front view.
High-potential iron-sulfur protein in PDB entry 5d8v, assembly 1, side view.
High-potential iron-sulfur protein in PDB entry 5d8v, assembly 1, top view.
Chain: A
Length: 83 amino acids
Theoretical weight: 8.79 KDa
Source organism: Thermochromatium tepidum
UniProt:
  • Canonical: P80176 (Residues: 1-83; Coverage: 100%)
Gene name: hip
FASTA Sequence
>pdb|5d8v|A
AAPANAVTADDPTAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQANVGEGDWKGCQLFPGKLINVNGWCASWTLKAG
PDBe-KB: UniProt Coverage View: P80176  
Loading Protvista...
Loading...
 
 
  5d8v: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins