Zinc finger and BTB domain-containing protein 17 in PDB entry 7azw ‹ PDBe

Chains: A, B
Length: 121 amino acids
Theoretical weight: 13.28 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: Q13105 (Residues: 1-115; Coverage: 14%)

Gene names: MIZ1, ZBTB17, ZNF151, ZNF60
FASTA Sequence


    >pdb|7azw|A B

GGSMASMDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLA

7azw:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.