ID EU006068; SV 1; linear; genomic DNA; STD; VRL; 177 BP. XX AC EU006068; XX DT 19-AUG-2007 (Rel. 92, Created) DT 28-AUG-2007 (Rel. 93, Last updated, Version 2) XX DE Tomato leaf curl New Delhi virus from cucumber AC4 protein gene, complete DE cds. XX KW . XX OS Tomato leaf curl New Delhi virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-177 RA Praveen S., Mishra A.K., Koundal V., Jain R.K.; RT ; RL Submitted (28-JUN-2007) to the INSDC. RL Division of Plant Pathology, Indian Agricultural Research Institute, IARI, RL New Delhi, New Delhi 110012, India XX DR MD5; e8b4fbc4e8aabb3d1dace610b820de0e. XX FH Key Location/Qualifiers FH FT source 1..177 FT /organism="Tomato leaf curl New Delhi virus" FT /host="cucumber" FT /mol_type="genomic DNA" FT /country="India:New Delhi" FT /db_xref="taxon:223347" FT CDS 1..177 FT /codon_start=1 FT /product="AC4 protein" FT /note="RNAi suppressor; pathogenicity determinant" FT /db_xref="GOA:A7U6C7" FT /db_xref="InterPro:IPR001301" FT /db_xref="InterPro:IPR022690" FT /db_xref="UniProtKB/TrEMBL:A7U6C7" FT /protein_id="ABU40638.1" FT /translation="MGLRISMFSSNSKGKFQCKNNRFFDLVSPSRSAHFHPNIQGAKSA FT SDVKAYIDKDGDV" XX SQ Sequence 177 BP; 55 A; 43 C; 37 G; 42 T; 0 other; atgggtctcc gcatatccat gttctcatcc aattcgaagg gaaaattcca gtgcaaaaat 60 aacagattct tcgacttggt gtccccaagt cggtcagcac atttccatcc gaacattcag 120 ggagctaaat cagcgtcaga tgtcaaagca tacatcgaca aagacggaga cgtttag 177 //