ID FR693199; SV 1; linear; genomic RNA; STD; VRL; 774 BP. XX AC FR693199; XX DT 22-SEP-2010 (Rel. 106, Created) DT 05-AUG-2023 (Rel. 144, Last updated, Version 3) XX DE Tomato spotted wilt virus segment S partial NP gene for nucleocapsid, DE isolate P35-1, genomic RNA XX KW . XX OS Orthotospovirus tomatomaculae OC Viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; OC Ellioviricetes; Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-774 RA Moury B.; RT ; RL Submitted (21-SEP-2010) to the INSDC. RL Moury B., Institut National de Recherche Agronomiq, Station de Pathologie RL Vegetale, Domaine St Maurice, BP94, F-84143 Montfavet Cedex, FRANCE. XX RN [2] RA Tentchev D., Verdin E., Marchal C., Jacquet M., Aguilar J.M., Moury B.; RT "Evolution and structure of Tomato spotted wilt virus populations: evidence RT of extensive reassortment and insights into emergence processes"; RL J. Gen. Virol. 92(Pt 4):961-973(2011). XX DR MD5; 8a95433b276aa536e84771b26da681fa. XX FH Key Location/Qualifiers FH FT source 1..774 FT /organism="Orthotospovirus tomatomaculae" FT /segment="S" FT /isolate="P35-1" FT /mol_type="genomic RNA" FT /country="Spain" FT /isolation_source="Capsicum" FT /collection_date="2007" FT /db_xref="taxon:3052585" FT CDS 1..>774 FT /gene="NP" FT /product="nucleocapsid" FT /db_xref="GOA:E1Y6F4" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:E1Y6F4" FT /protein_id="CBX24285.1" FT /translation="MSKVKLTKESIVALLTQGKDLEFEEDQNLVAFNFKTFCLENLDQI FT KKMSVISCLTFLKNRQSIMKVIKQSDFTFGKITIKKTSDRIGATDMTFRRLDSLIRVRL FT VEETGNSENLNTIKSKIASHPLIQAYGLPLDDAKSVRLAIMLGGSLPLIASVDSFEMIS FT VVLAIYQDAKYKDLGIDPKKYDTREALGKVCTVLKSKAFEMNEDQVKKGKEYAAILSSS FT NPNAKGSIAMEHYSETLNKFYEMFGVKKQAKLTELA" XX SQ Sequence 774 BP; 251 A; 133 C; 176 G; 214 T; 0 other; atgtctaagg ttaagctcac taaggaaagc atcgttgctt tgttgacaca aggcaaagac 60 cttgagtttg aggaagatca gaatctggta gcattcaact tcaagacttt ttgtctggaa 120 aaccttgacc agatcaaaaa gatgagcgtt atttcatgtc tgacattctt gaagaatcgt 180 cagagcataa tgaaggttat caagcagagt gattttactt ttggtaaaat taccataaag 240 aaaacttcag acaggattgg agccactgac atgaccttca gaaggcttga tagcttgatc 300 agggtcaggc ttgttgaaga aactgggaat tctgagaatc tcaatactat caaatctaag 360 attgcttccc accctttgat tcaagcctat ggattacctc ttgatgatgc aaagtctgtg 420 aggcttgcca taatgctggg aggtagctta cctcttattg cttcagttga tagctttgag 480 atgatcagtg ttgtcttggc tatatatcag gatgcaaaat acaaggacct cgggatcgac 540 ccaaagaagt atgacaccag ggaagcttta ggaaaagttt gcactgtgct gaaaagcaaa 600 gcatttgaga tgaatgaaga tcaggtgaag aaggggaaag agtatgctgc tatacttagc 660 tccagcaatc ctaatgctaa aggaagtatt gctatggaac attacagtga aactcttaac 720 aagttctatg aaatgtttgg ggttaaaaaa caggcaaaac tcacagaact tgct 774 //