ID J02150; SV 1; linear; genomic RNA; STD; VRL; 890 BP. XX AC J02150; XX DT 13-JAN-1992 (Rel. 30, Created) DT 31-MAY-2006 (Rel. 88, Last updated, Version 4) XX DE Influenza A virus (A/Puerto Rico/8/34(H1N1)) segment 8, complete sequence. XX KW complete genome. XX OS Influenza A virus (A/Puerto Rico/8/1934(H1N1)) OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Insthoviricetes; OC Articulavirales; Orthomyxoviridae; Alphainfluenzavirus. XX RN [1] RP 1-890 RX DOI; 10.1093/nar/8.23.5845. RX PUBMED; 7465426. RA Baez M., Taussig R., Zazra J.J., Young J.F., Palese P., Reisfeld A., RA Skalka A.M.; RT "Complete nucleotide sequence of the influenza A/PR/8/34 virus NS gene and RT comparison with the NS genes of the A/Udorn/72 and A/FPV/Rostock/34 RT strains"; RL Nucleic Acids Res. 8(23):5845-5858(1980). XX RN [2] RP 6-131 RX DOI; 10.1016/0042-6822(80)90188-9. RX PUBMED; 7385583. RA Air G.M., Hackett J.A.; RT "Gene 8 of influenza virus: sequences of cDNA transcribed from the 3' ends RT of viral RNA of influenza A and B strains"; RL Virology 103(2):291-298(1980). XX RN [3] RP 1-247 RX PUBMED; 7241645. RA Hall R.M., Air G.M.; RT "Variation in nucleotide sequences coding for the N-terminal regions of the RT matrix and nonstructural proteins of influenza A viruses"; RL J. Virol. 38(1):1-7(1981). XX RN [4] RP 1-890 RX DOI; 10.1093/nar/9.2.237. RX PUBMED; 7208353. RA Winter G., Fields S., Gait M.J., Brownlee G.G.; RT "The use of synthetic oligodeoxynucleotide primers in cloning and RT sequencing segment of 8 influenza virus (A/PR/8/34)"; RL Nucleic Acids Res. 9(2):237-245(1981). XX DR MD5; 57151e6196306db5d9f33133572a5482. DR EuropePMC; PMC2040185; 18784792. DR EuropePMC; PMC2175529; 18197240. DR EuropePMC; PMC2386737; 18411420. DR EuropePMC; PMC2440663; 18400345. DR EuropePMC; PMC2643796; 19052087. DR EuropePMC; PMC3648185; 23468495. DR EuropePMC; PMC4430168; 25969984. DR RFAM; RF01099; PK-IAV. XX FH Key Location/Qualifiers FH FT source 1..890 FT /organism="Influenza A virus (A/Puerto Rico/8/1934(H1N1))" FT /segment="8" FT /strain="A/Puerto Rico/8/34" FT /serotype="H1N1" FT /mol_type="genomic RNA" FT /db_xref="taxon:211044" FT CDS join(27..56,529..864) FT /codon_start=1 FT /product="nonstructural protein ns2" FT /db_xref="GOA:P03508" FT /db_xref="InterPro:IPR000968" FT /db_xref="PDB:1PD3" FT /db_xref="UniProtKB/Swiss-Prot:P03508" FT /protein_id="AAA43535.1" FT /translation="MDPNTVSSFQDILLRMSKMQLESSSEDLNGMITQFESLKLYRDSL FT GEAVMRMGDLHSLQNRNEKWREQLGQKFEEIRWLIEEVRHKLKVTENSFEQITFMQALH FT LLLEVEQEIRTFSFQLI" FT CDS 27..719 FT /codon_start=1 FT /product="nonstructural protein ns1" FT /db_xref="GOA:P03496" FT /db_xref="InterPro:IPR000256" FT /db_xref="InterPro:IPR004208" FT /db_xref="InterPro:IPR009068" FT /db_xref="InterPro:IPR038064" FT /db_xref="PDB:2GX9" FT /db_xref="PDB:2ZKO" FT /db_xref="PDB:3L4Q" FT /db_xref="PDB:3O9Q" FT /db_xref="PDB:3O9R" FT /db_xref="PDB:3O9S" FT /db_xref="PDB:3O9T" FT /db_xref="PDB:3O9U" FT /db_xref="PDB:3RVC" FT /db_xref="PDB:5NT1" FT /db_xref="PDB:5NT2" FT /db_xref="UniProtKB/Swiss-Prot:P03496" FT /protein_id="AAA43536.1" FT /translation="MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRG FT RGSTLGLDIETATRAGKQIVERILKEESDEALKMTMASVPASRYLTDMTLEEMSREWSM FT LIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPL FT PSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLTPKQKREM FT AGTIRSEV" XX SQ Sequence 890 BP; 285 A; 179 C; 215 G; 211 T; 0 other; agcaaaagca gggtgacaaa gacataatgg atccaaacac tgtgtcaagc tttcaggtag 60 attgctttct ttggcatgtc cgcaaacgag ttgcagacca agaactaggt gatgccccat 120 tccttgatcg gcttcgccga gatcagaaat ccctaagagg aaggggcagc actcttggtc 180 tggacatcga gacagccaca cgtgctggaa agcagatagt ggagcggatt ctgaaagaag 240 aatccgatga ggcacttaaa atgaccatgg cctctgtacc tgcgtcgcgt tacctaaccg 300 acatgactct tgaggaaatg tcaagggaat ggtccatgct catacccaag cagaaagtgg 360 caggccctct ttgtatcaga atggaccagg cgatcatgga taaaaacatc atactgaaag 420 cgaacttcag tgtgattttt gaccggctgg agactctaat attgctaagg gctttcaccg 480 aagagggagc aattgttggc gaaatttcac cattgccttc tcttccagga catactgctg 540 aggatgtcaa aaatgcagtt ggagtcctca tcggaggact tgaatggaat gataacacag 600 ttcgagtctc tgaaactcta cagagattcg cttggagaag cagtaatgag aatgggagac 660 ctccactcac tccaaaacag aaacgagaaa tggcgggaac aattaggtca gaagtttgaa 720 gaaataagat ggttgattga agaagtgaga cacaaactga aggtaacaga gaatagtttt 780 gagcaaataa catttatgca agccttacat ctattgcttg aagtggagca agagataaga 840 actttctcat ttcagcttat ttaataataa aaaacaccct tgtttctact 890 //