ID JF699625; SV 1; linear; genomic RNA; STD; VRL; 945 BP. XX AC JF699625; XX DT 31-MAR-2013 (Rel. 116, Created) DT 24-SEP-2013 (Rel. 118, Last updated, Version 2) XX DE Sweet potato feathery mottle virus isolate HN:5RC:08 coat protein gene, DE partial cds. XX KW . XX OS Sweet potato feathery mottle virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-945 RX DOI; .1094/PDIS-03-12-0268-RE. RX PUBMED; 30727310. RA Kashif N., Pietila S., Artola K., Jones R.A.C., Tugume A.K., Makinen V., RA Valkonen J.P.T.; RT "Detection of Viruses in Sweetpotato from Honduras and Guatemala Augmented RT by Deep-Sequencing of Small-RNAs"; RL Plant Dis. 96(10):1430-1437(2012). XX RN [2] RP 1-945 RA Muhammad K., Tugume A.K., Valkonen J.P.T.; RT "Detection and characterization of viruses in sweet potatoes (Ipomoea RT batatas L.) from Guatemala and Honduras"; RL Unpublished. XX RN [3] RP 1-945 RA Muhammad K., Tugume A.K., Valkonen J.P.T.; RT ; RL Submitted (16-MAR-2011) to the INSDC. RL Department of Agricultural Science, University of Helsinki, RL Latokartanonkaari 7, Helsinki FIN-00014, Finland XX DR MD5; 971dc6ca393ea1d7a0e2d3042cc4dbc2. XX FH Key Location/Qualifiers FH FT source 1..945 FT /organism="Sweet potato feathery mottle virus" FT /host="Ipomoea batatas" FT /isolate="HN:5RC:08" FT /mol_type="genomic RNA" FT /country="Honduras:Copan" FT /collection_date="2008" FT /db_xref="taxon:12844" FT CDS <1..>945 FT /codon_start=1 FT /product="coat protein" FT /note="capsid protein" FT /db_xref="GOA:M4GQJ1" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/TrEMBL:M4GQJ1" FT /protein_id="AFD22452.1" FT /translation="SSERTEFKDAGANPPAPKPKDIPPPPTITEVTDPEDPKQAALRAA FT RAKQPATIPESYGRDTSKEKESIVGASSKGVKDKDVNVGTVGTFVVQRVKMNANKKRQP FT MVNGRAIINFQHLSTYEPEQFEVANTRSTQEQFQAWYEGVKGDYGVDDTGMGILLNGLM FT VWCIENGTSPNINGVWTMMDGDEQVTYPIKPLLDHAVPTFRQIMTHFSDVAEAYIEMRN FT RTKAYMPRYGLQRNLTDMSLARYAFDFYELHSTTPARAKEAHLQMKAAALKNAKNRLFG FT LDGNVSTQEEDTERHTTTDVTRNIHNLLGMRGVQ" XX SQ Sequence 945 BP; 313 A; 185 C; 234 G; 213 T; 0 other; tctagtgaac gtactgagtt caaagatgca ggggcgaacc ctccagcccc taagcctaag 60 gacatccctc caccacccac aataactgag gtcactgatc cagaagaccc aaagcaggca 120 gctttaagag ctgcacgagc taagcaacct gcaaccattc cagaatcata tggacgagac 180 actagcaagg agaaggaatc aatagtgggg gcatcatcaa agggtgtgaa ggataaagat 240 gtaaacgttg gtacagttgg tacgtttgtc gtacaacgtg ttaaaatgaa tgcaaacaag 300 aaaaggcaac caatggtaaa tggaagggcc attataaatt tccaacactt gtcaacatat 360 gagccagaac agtttgaggt tgcaaacacc cggtcgactc aagaacagtt tcaagcatgg 420 tatgaaggag taaaagggga ctatggtgtt gacgatacag gaatggggat cttattgaat 480 ggattaatgg tttggtgcat tgaaaatggc acatccccaa atataaatgg tgtgtggaca 540 atgatggatg gtgatgagca agtgacatat ccaattaaac cattgttgga ccatgcagtg 600 cctactttta ggcagattat gacgcacttc agtgacgttg ctgaagctta catagagatg 660 cgaaatcgta caaaggcgta catgccaagg tacggtttac aacgtaattt gactgatatg 720 agtcttgcgc gatatgcatt tgatttctac gagctgcatt caaccacccc tgcacgtgca 780 aaagaagcac atttacagat gaaggcagcc gcacttaaga atgcgaaaaa tcggttgttt 840 ggtttggacg gaaacgtctc cacgcaagaa gaagatacgg agaggcacac gacaactgat 900 gttactagaa atatacataa cctcttagga atgaggggtg tgcaa 945 //