CHEBI:80330 - peptide YY

Main ChEBI Ontology Automatic Xrefs Reactions Pathways Models
ChEBI Name peptide YY
ChEBI ID CHEBI:80330
Definition A 36-membered human gut polypeptide consisting of Tyr, Pro, Ile, Lys, Pro, Glu, Ala, Pro, Gly, Glu, Asp, Ala, Ser, Pro, Glu, Glu, Leu, Asn, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, His, Tyr, Leu, Asn, Leu, Val, Thr, Arg, Gln, Arg and Tyr-NH2 residues joined in sequence.
Stars This entity has been manually annotated by the ChEBI Team.
Wikipedia License
Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. Peptide YY is a short (36-amino acid) peptide released from cells in the ileum and colon in response to feeding. In the blood, gut, and other elements of periphery, PYY acts to reduce appetite; similarly, when injected directly into the central nervous system, PYY is also anorexigenic, i.e., it reduces appetite. Dietary fibers from fruits, vegetables, and whole grains, consumed, increase the speed of transit of intestinal chyme into the ileum, to raise PYY3-36, and induce satiety. Peptide YY cannot be produced as the result of enzymatic breakdown of crude fish proteins and ingested as a food product.
Read full article at Wikipedia
Roles Classification
Chemical Role(s): Bronsted base
A molecular entity capable of accepting a hydron from a donor (Bronsted acid).
(via organic amino compound )
Biological Role(s): neuropeptide Y2 receptor agonist
An agonist that binds to and activates neuropeptide Y2 receptors.
human metabolite
Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens).
hormone
Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds.
(via peptide hormone )
Application(s): appetite depressant
Any agent that is used to decrease appetite.
View more via ChEBI Ontology
ChEBI Ontology
Outgoing peptide YY (CHEBI:80330) has role appetite depressant (CHEBI:50507)
peptide YY (CHEBI:80330) has role human metabolite (CHEBI:77746)
peptide YY (CHEBI:80330) has role neuropeptide Y2 receptor agonist (CHEBI:138168)
peptide YY (CHEBI:80330) is a peptide hormone (CHEBI:25905)
peptide YY (CHEBI:80330) is a peptidyl amide (CHEBI:15722)
peptide YY (CHEBI:80330) is a polypeptide (CHEBI:15841)
Synonyms Sources
peptide tyrosine tyrosine ChEBI
PYY (3-36) ChEBI
PYY 3-36 ChEBI
PYY3-36 ChEBI
Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 ChEBI
YPIKPEAPGEDASPEELNYYASLRHYLNLVTRQRY-NH2 ChEBI
Manual Xrefs Databases
C16118 KEGG COMPOUND
Peptide_YY Wikipedia
View more database links
Registry Numbers Types Sources
1366182-03-7 CAS Registry Number ChemIDplus
9754261 Reaxys Registry Number Reaxys
Citations
Nishizawa N, Niida A, Masuda Y, Kumano S, Yokoyama K, Hirabayashi H, Amano N, Ohtaki T, Asami T (2017)
Antiobesity Effect of a Short-Length Peptide YY Analogue after Continuous Administration in Mice.
ACS medicinal chemistry letters 8, 628-631 [PubMed:28626523]
[show Abstract]
Reverri EJ, Randolph JM, Kappagoda CT, Park E, Edirisinghe I, Burton-Freeman BM (2017)
Assessing beans as a source of intrinsic fiber on satiety in men and women with metabolic syndrome.
Appetite 118, 75-81 [PubMed:28735851]
[show Abstract]
Nishizawa N, Niida A, Adachi Y, Masuda Y, Kumano S, Yokoyama K, Asakawa T, Hirabayashi H, Amano N, Takekawa S, Ohtaki T, Asami T (2017)
Potent antiobesity effect of a short-length peptide YY-analogue continuously administered in mice.
Bioorganic & medicinal chemistry letters 27, 3829-3832 [PubMed:28684122]
[show Abstract]
Shi YC, Ip CK, Reed F, Sarruf DA, Wulff BS, Herzog H (2017)
Y5 receptor signalling counteracts the anorectic effects of PYY3-36 in diet-induced obese mice.
Journal of neuroendocrinology 29, [PubMed:28485050]
[show Abstract]
Saito R, Sonoda S, Ueno H, Motojima Y, Yoshimura M, Maruyama T, Hashimoto H, Tanaka K, Yamamoto Y, Kusuhara K, Ueta Y (2017)
Involvement of central nesfatin-1 neurons on oxytocin-induced feeding suppression in rats.
Neuroscience letters 655, 54-60 [PubMed:28684238]
[show Abstract]
Steinert RE, Feinle-Bisset C, Asarian L, Horowitz M, Beglinger C, Geary N (2017)
Ghrelin, CCK, GLP-1, and PYY(3-36): Secretory Controls and Physiological Roles in Eating and Glycemia in Health, Obesity, and After RYGB.
Physiological reviews 97, 411-463 [PubMed:28003328]
[show Abstract]
Yamaguchi E, Yasoshima Y, Shimura T (2017)
Systemic administration of anorexic gut peptide hormones impairs hedonic-driven sucrose consumption in mice.
Physiology & behavior 171, 158-164 [PubMed:28040488]
[show Abstract]
Hassan AM, Jain P, Mayerhofer R, Fröhlich EE, Farzi A, Reichmann F, Herzog H, Holzer P (2017)
Visceral hyperalgesia caused by peptide YY deletion and Y2 receptor antagonism.
Scientific reports 7, 40968 [PubMed:28106168]
[show Abstract]
Zhang J, Jia H, Wang Q, Zhang Y, Wu W, Zhang H (2017)
Role of Peptide YY3-36 and Glucose-Dependent Insulinotropic Polypeptide in Anorexia Induction by Trichothecences T-2 Toxin, HT-2 Toxin, Diacetoxyscirpenol, and Neosolaniol.
Toxicological sciences : an official journal of the Society of Toxicology 159, 203-210 [PubMed:28666375]
[show Abstract]
Hickson M, Moss C, Dhillo WS, Bottin J, Frost G (2016)
Increased peptide YY blood concentrations, not decreased acyl-ghrelin, are associated with reduced hunger and food intake in healthy older women: Preliminary evidence.
Appetite 105, 320-327 [PubMed:27264721]
[show Abstract]
Henry KE, Kerwood DJ, Allis DG, Workinger JL, Bonaccorso RL, Holz GG, Roth CL, Zubieta J, Doyle RP (2016)
Solution Structure and Constrained Molecular Dynamics Study of Vitamin B12 Conjugates of the Anorectic Peptide PYY(3-36).
ChemMedChem 11, 1015-1021 [PubMed:27027248]
[show Abstract]
Kuehl PJ, Boyden T, Dobry DE, Doyle-Eisele M, Friesen DT, McDonald JD, Murri BG, Vodak DT, Lyon DK (2016)
Inhaled PYY(3-36) dry-powder formulation for appetite suppression.
Drug development and industrial pharmacy 42, 150-156 [PubMed:26006332]
[show Abstract]
Gonzalez R, Unniappan S (2016)
Mass spectrometry-assisted confirmation of the inability of dipeptidyl peptidase-4 to cleave goldfish peptide YY(1-36) and the lack of anorexigenic effects of peptide YY(3-36) in goldfish (Carassius auratus).
Fish physiology and biochemistry 42, 831-844 [PubMed:26676513]
[show Abstract]
Svane MS, Jørgensen NB, Bojsen-Møller KN, Dirksen C, Nielsen S, Kristiansen VB, Toräng S, Wewer Albrechtsen NJ, Rehfeld JF, Hartmann B, Madsbad S, Holst JJ (2016)
Peptide YY and glucagon-like peptide-1 contribute to decreased food intake after Roux-en-Y gastric bypass surgery.
International journal of obesity (2005) 40, 1699-1706 [PubMed:27434221]
[show Abstract]
Khan D, Vasu S, Moffett RC, Irwin N, Flatt PR (2016)
Islet distribution of Peptide YY and its regulatory role in primary mouse islets and immortalised rodent and human beta-cell function and survival.
Molecular and cellular endocrinology 436, 102-113 [PubMed:27465830]
[show Abstract]
Olsen J, Kofoed J, Østergaard S, Wulff BS, Nielsen FS, Jorgensen R (2016)
Metabolism of peptide YY 3-36 in Göttingen mini-pig and rhesus monkey.
Peptides 78, 59-67 [PubMed:26774588]
[show Abstract]
Reidelberger R, Haver A, Anders K, Apenteng B, Lanio C (2016)
Effects of solid-phase extraction of plasma in measuring gut metabolic hormones in fasted and fed blood of lean and diet-induced obese rats.
Physiological reports 4, e12800 [PubMed:27207785]
[show Abstract]
Schmidt JB, Sjödin A, Stevner LS, Ritz C, Michaelsen NB, Thomsen AB, Holst JJ, Astrup A (2016)
Serum lipase activity and concentration during intravenous infusions of GLP-1 and PYY3-36 and after ad libitum meal ingestion in overweight men.
Physiological reports 4, e12980 [PubMed:27670407]
[show Abstract]
Alhadeff AL, Golub D, Hayes MR, Grill HJ (2015)
Peptide YY signaling in the lateral parabrachial nucleus increases food intake through the Y1 receptor.
American journal of physiology. Endocrinology and metabolism 309, E759-66 [PubMed:26330345]
[show Abstract]
Siahanidou T, Margeli A, Tsirogianni C, Hantzi E, Papassotiriou I, Chrousos G (2015)
Elevated circulating ghrelin, but not peptide YY(3-36) levels, in term neonates with infection.
Clinical chemistry and laboratory medicine 53, 1815-1824 [PubMed:25870965]
[show Abstract]
Henry KE, Elfers CT, Burke RM, Chepurny OG, Holz GG, Blevins JE, Roth CL, Doyle RP (2015)
Vitamin B12 conjugation of peptide-YY(3-36) decreases food intake compared to native peptide-YY(3-36) upon subcutaneous administration in male rats.
Endocrinology 156, 1739-1749 [PubMed:25658456]
[show Abstract]
Stadlbauer U, Woods SC, Langhans W, Meyer U (2015)
PYY3-36: Beyond food intake.
Frontiers in neuroendocrinology 38, 1-11 [PubMed:25527432]
[show Abstract]
Eddy KT, Lawson EA, Meade C, Meenaghan E, Horton SE, Misra M, Klibanski A, Miller KK (2015)
Appetite regulatory hormones in women with anorexia nervosa: binge-eating/purging versus restricting type.
The Journal of clinical psychiatry 76, 19-24 [PubMed:25098834]
[show Abstract]
Prado WL, Balagopal PB, Lofrano-Prado MC, Oyama LM, Tenório TR, Botero JP, Hill JO (2014)
Effect of aerobic exercise on hunger feelings and satiety regulating hormones in obese teenage girls.
Pediatric exercise science 26, 463-469 [PubMed:25372381]
[show Abstract]
Last Modified
11 August 2017