ID AAM64290; SV 1; linear; mRNA; STD; PLN; 465 BP. XX PA AY086212.1 XX DT 14-JUN-2002 (Rel. 72, Created) DT 24-FEB-2006 (Rel. 86, Last updated, Version 4) XX DE Arabidopsis thaliana (thale cress) 60S ribosomal protein L23A XX KW FLI_CDNA. XX OS Arabidopsis thaliana (thale cress) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. XX RN [1] RX PUBMED; 12093376. RA Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N., RA Feldmann K.A., Flavell R.B., White O., Salzberg S.L.; RT "Full-length messenger RNA sequences greatly improve genome annotation"; RL Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002). XX RN [2] RA Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.; RT "Features of Arabidopsis genes and genome discovered using full-length RT cDNAs"; RL Plant Mol. Biol. 60(1):71-87(2006). XX RN [3] RA Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.; RT ; RL Submitted (11-MAR-2002) to the INSDC. RL Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA XX DR MD5; 4dd8a9321f3583bd00711a937c9c08e2. XX FH Key Location/Qualifiers FH FT source 1..465 FT /organism="Arabidopsis thaliana" FT /mol_type="mRNA" FT /clone="22479" FT /db_xref="taxon:3702" FT CDS AY086212.1:61..525 FT /codon_start=1 FT /product="60S ribosomal protein L23A" FT /db_xref="GOA:Q8LD46" FT /db_xref="InterPro:IPR001014" FT /db_xref="InterPro:IPR005633" FT /db_xref="InterPro:IPR012677" FT /db_xref="InterPro:IPR012678" FT /db_xref="InterPro:IPR013025" FT /db_xref="InterPro:IPR019985" FT /db_xref="UniProtKB/Swiss-Prot:Q8LD46" FT /protein_id="AAM64290.1" FT /translation="MSPAKVDTTKKADPKAKALKAAKAVKSGQAFKKKGKKIRTKVTFH FT RPKTLTKPRTGKYPKISATPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADK FT KKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII" XX SQ Sequence 465 BP; 158 A; 105 C; 103 G; 99 T; 0 other; atgtctccgg ctaaagttga tactaccaag aaggctgatc ctaaggccaa ggccttgaag 60 gcggcaaagg ctgtgaagtc tggtcaagcc ttcaagaaga agggcaaaaa gattaggacc 120 aaggtcacct tccacaggcc aaagactctt accaagccta gaactggtaa gtacccaaaa 180 atcagcgcta ctccaaggaa caagttggat cactaccaaa tccttaagta cccactcacc 240 actgaatctg cgatgaagaa gattgaagac aacaacactc ttgttttcat tgttgacatt 300 cgtgctgaca agaagaagat taaggatgct gttaagaaga tgtatgacat ccagaccaag 360 aaagtgaaca cactcatcag gcctgatgga accaagaagg cttacgtgag gcttacacca 420 gactatgatg ctttggatgt tgctaacaag atcggcatca tctaa 465 //