ID AAO66181; SV 1; linear; genomic DNA; STD; PLN; 108 BP. XX PA AY181941.1 XX DT 01-JUN-2003 (Rel. 76, Created) DT 16-DEC-2008 (Rel. 98, Last updated, Version 4) XX DE Salicornia europaea photosystem II subunit XX KW . XX OS Salicornia europaea OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC Caryophyllales; Chenopodiaceae; Salicornioideae; Salicornia; OC Salicornia subg. Salicornia. OG Plastid:chloroplast XX RN [1] RA Schuetze P., Freitag H., Weising K.; RT "An integrated molecular and morphological study of the subfamily RT Suaedoideae Ulbr. (Chenopodiaceae)"; RL Plant Syst. Evol. 239:257-286(2003). XX RN [2] RA Schuetze P., Freitag H., Weising K.; RT ; RL Submitted (16-NOV-2002) to the INSDC. RL Biology/Chemistry, Plant Molecular Systematics, University of Kassel, RL Kassel 34109, Germany XX DR MD5; f4f315aae24328e072a4bf62bb16ea06. XX FH Key Location/Qualifiers FH FT source 1..108 FT /organism="Salicornia europaea" FT /organelle="plastid:chloroplast" FT /mol_type="genomic DNA" FT /specimen_voucher="Schuetze1081" FT /db_xref="taxon:206448" FT CDS AY181941.1:226..333 FT /codon_start=1 FT /transl_table=11 FT /gene="psbT" FT /product="photosystem II subunit" FT /db_xref="GOA:Q7GZA2" FT /db_xref="InterPro:IPR001743" FT /db_xref="InterPro:IPR037268" FT /db_xref="UniProtKB/Swiss-Prot:Q7GZA2" FT /protein_id="AAO66181.1" FT /translation="MEALVYTFLLVSTLGIIFFAIFFREPPKIQTKKMK" XX SQ Sequence 108 BP; 36 A; 15 C; 17 G; 40 T; 0 other; atggaagcat tggtttatac atttttatta gtctcgactc tagggataat ttttttcgct 60 atctttttta gggaacctcc taaaatacaa actaaaaaga tgaaatga 108 //