ID AB828280; SV 1; linear; genomic DNA; STD; INV; 244 BP. XX AC AB828280; XX DT 07-AUG-2013 (Rel. 117, Created) DT 07-AUG-2013 (Rel. 117, Last updated, Version 1) XX DE Crematogaster fraxatrix mitochondrial COI gene for cytochrome oxidase DE subunit 1, partial cds, isolate: KUMANT007LepF1. XX KW . XX OS Crematogaster fraxatrix OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata; Formicoidea; OC Formicidae; Myrmicinae; Crematogaster; Crematogaster. OG Mitochondrion XX RN [1] RP 1-244 RA Hosoishi S., Ogata K.; RT ; RL Submitted (24-JUN-2013) to the INSDC. RL Contact:Shingo Hosoishi Kyushu University, Institute of Tropical RL Agriculture; 6-10-1 Hakozaki, Higashi-ku, Fukuoka, Fukuoka 812-8581, Japan RL URL :http://bbs1.agr.kyushu-u.ac.jp/tropic/ XX RN [2] RA Hosoishi S.; RT "Description and DNA barcoding of Crematogaster fraxatrix and two new RT closely related species from Cambodia and Indonesia"; RL Unpublished. XX DR MD5; a5b330b1ddf56b1b21e27b93d4554a2b. XX FH Key Location/Qualifiers FH FT source 1..244 FT /organism="Crematogaster fraxatrix" FT /organelle="mitochondrion" FT /isolate="KUMANT007LepF1" FT /mol_type="genomic DNA" FT /country="Malaysia:W. Malaysia, Johor" FT /db_xref="taxon:1201983" FT CDS <1..>244 FT /codon_start=3 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:S6BUE4" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:S6BUE4" FT /protein_id="BAN67837.1" FT /translation="LICDDQIYKVLVTSHAFIMIFFMVMPFMIGGFGNFLVPLMLGSPD FT MAYPRMNNMSFWLLPPSIALLILSSFLNTGVGTGWT" XX SQ Sequence 244 BP; 73 A; 50 C; 37 G; 84 T; 0 other; ccctaatctg tgacgaccaa atttataagg ttttagtaac aagacatgct tttattataa 60 ttttctttat agttataccc ttcataatcg gagggtttgg aaatttttta gtccccctta 120 tgcttggctc acctgacata gcttacccac gaataaataa tataagattt tgactcctac 180 ccccatctat cgccctactt attttaagaa gattcttaaa tactggggta ggaacaggat 240 gaac 244 //