ID ACN38627; SV 1; linear; genomic DNA; STD; VRT; 96 BP. XX PA FJ167737.1 XX DT 31-AUG-2009 (Rel. 102, Created) DT 23-JAN-2010 (Rel. 103, Last updated, Version 2) XX DE Chaetodon capistratus (four-eye butterflyfish) partial ETS-2 oncogene XX KW . XX OS Chaetodon capistratus (four-eye butterflyfish) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; OC Eupercaria; Chaetodontiformes; Chaetodontidae; Chaetodon. XX RN [1] RX DOI; 10.1111/j.1420-9101.2009.01904.x. RX PUBMED; 20487131. RA Bellwood D.R., Klanten S., Cowman P.F., Pratchett M.S., Konow N., RA van Herwerden L.; RT "Evolutionary history of the butterflyfishes (f: Chaetodontidae) and the RT rise of coral feeding fishes"; RL J. Evol. Biol. 23(2):335-349(2010). XX RN [2] RA Bellwood D.R., Klanten O.S., Pratchett M.S., Konow N., van Herwerden L.; RT ; RL Submitted (26-AUG-2008) to the INSDC. RL School of Marine and Tropical Biology, James Cook University, Townsville, RL Queensland 4811, Australia XX DR MD5; 2946e9521164f59bba58c70160957d7e. XX FH Key Location/Qualifiers FH FT source 1..96 FT /organism="Chaetodon capistratus" FT /isolate="M474" FT /mol_type="genomic DNA" FT /db_xref="taxon:37949" FT CDS FJ167737.1:<1..>96 FT /codon_start=1 FT /product="ETS-2 oncogene" FT /db_xref="GOA:C7SFA2" FT /db_xref="InterPro:IPR000418" FT /db_xref="InterPro:IPR036388" FT /db_xref="InterPro:IPR036390" FT /db_xref="UniProtKB/TrEMBL:C7SFA2" FT /protein_id="ACN38627.1" FT /translation="QFLLELLTDKSCQSFISWTGDGWEFKLSDPDE" XX SQ Sequence 96 BP; 19 A; 26 C; 28 G; 23 T; 0 other; cagtttcttc tggagctgct gaccgacaag tcttgccagt ccttcatcag ctggacaggc 60 gacggctggg agttcaagct gtctgaccca gatgag 96 //