ID AGJ89670; SV 1; linear; genomic DNA; STD; ENV; 495 BP. XX PA JX644930.1 XX DT 08-OCT-2013 (Rel. 118, Created) DT 08-OCT-2013 (Rel. 118, Last updated, Version 1) XX DE uncultured prokaryote partial formate dehydrogenase H subunit alpha XX KW ENV. XX OS uncultured prokaryote OC unclassified sequences; environmental samples. XX RN [1] RP 1-495 RA Rosenthal A.Z., Zhang X., Lucey K.S., Ottesen E.A., Choi H.M.T., RA Calvert C.R., Pierce N.A., Leadbetter J.R.; RT "When phylogenetic inference is wrong: single-cell analyses link bacteria RT with abundant transcripts"; RL Unpublished. XX RN [2] RP 1-495 RA Rosenthal A.Z., Zhang X., Lucey K.S., Ottesen E.A., Choi H.M.T., RA Calvert C.R., Pierce N.A., Leadbetter J.R.; RT ; RL Submitted (06-SEP-2012) to the INSDC. RL Dept of Environmental Science and Engineering, California Institute of RL Technology, 1200 East California Blvd., Pasadena, CA 91125, USA XX DR MD5; ca26d1c5e0c40ba61ff0d39e27c20198. XX FH Key Location/Qualifiers FH FT source 1..495 FT /organism="uncultured prokaryote" FT /host="Zootermopsis nevadensis" FT /environmental_sample FT /mol_type="genomic DNA" FT /country="USA" FT /isolation_source="termite hindgut" FT /clone="ZnChp3b_83cys" FT /db_xref="taxon:198431" FT CDS JX644930.1:<1..>495 FT /codon_start=1 FT /transl_table=11 FT /gene="fdhF" FT /product="formate dehydrogenase H subunit alpha" FT /EC_number="1.1.99.33" FT /db_xref="GOA:U3LT79" FT /db_xref="InterPro:IPR006656" FT /db_xref="UniProtKB/TrEMBL:U3LT79" FT /protein_id="AGJ89670.1" FT /translation="YNAAASHPIVARRIVKAKEKGAYIICADPRITETARISDLHLQLK FT GGSNVALVNSMANVIISEDLIDHEFVKAHTKGFDEFWAIVKEYTPEYASTITGLSAEDI FT RFTARKYASSKHSVILWGMGITQFSQGVETVKCCCSLAMLTGNFGRPSCGTGPVRGQNN FT VQ" XX SQ Sequence 495 BP; 116 A; 141 C; 130 G; 108 T; 0 other; tataatgcgg cggcttccca ccccattgtg gcccgccgta tcgtcaaggc caaggaaaag 60 ggcgcctata tcatctgcgc cgatccccgg atcaccgaga ccgcccgtat ttccgacctg 120 catttgcaat tgaagggcgg atcaaatgtg gccctggtaa attccatggc caatgtgatc 180 atcagcgaag atttaataga ccatgagttt gtaaaggccc ataccaaggg ttttgatgaa 240 ttctgggcga tcgtcaagga atataccccc gaatacgcct caaccatcac cggcctttct 300 gcggaggata tacgctttac ggcccggaag tacgcaagct ccaagcactc ggtcatcctt 360 tggggcatgg gcattaccca gttctcccag ggtgttgaaa cggttaaatg ctgttgcagc 420 cttgccatgc tcaccgggaa cttcggacgg cccagttgcg gcacaggccc tgtccgggga 480 cagaacaacg tgcag 495 //