ID BAE24524; SV 1; linear; mRNA; HTC; MUS; 425 BP. XX PA AK140936.1 XX DT 06-SEP-2005 (Rel. 85, Created) DT 07-OCT-2010 (Rel. 106, Last updated, Version 10) XX DE Mus musculus (house mouse) hypothetical protein XX KW CAP trapper; HTC; HTC. XX OS Mus musculus (house mouse) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; OC Murinae; Mus; Mus. XX RN [1] RA Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F., RA Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M., RA Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K., RA Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T., RA Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.; RT ; RL Submitted (30-MAR-2004) to the INSDC. RL Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical RL Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22 RL Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL RL :http://www.osc.riken.jp/ XX RN [2] RX PUBMED; 16141072. RG The FANTOM Consortium, Riken Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group) RA ; RT "The Transcriptional Landscape of the Mammalian Genome"; RL Science, e1252229 309(5740):1559-1563(2005). XX RN [3] RX DOI; 10.1126/science.1112009. RX PUBMED; 16141073. RG RIKEN Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group) and the FANTOM Consortium RA ; RT "Antisense Transcription in the Mammalian Transcriptome"; RL Science, e1252229 309(5740):1564-1566(2005). XX RN [4] RX PUBMED; 12466851. RG The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase I and II Team RA ; RT "Analysis of the mouse transcriptome based on functional annotation of RT 60,770 full-length cDNAs"; RL Nature 420(6915):563-573(2002). XX RN [5] RX PUBMED; 11217851. RG The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM Consortium RA ; RT "Functional annotation of a full-length mouse cDNA collection"; RL Nature 409(6821):685-690(2001). XX RN [6] RX DOI; 10.1016/S0076-6879(99)03004-9. RX PUBMED; 10349636. RA Carninci P., Hayashizaki Y.; RT "High-efficiency full-length cDNA cloning"; RL Meth. Enzymol. 303:19-44(1999). XX RN [7] RX DOI; 10.1101/gr.145100. RX PUBMED; 11042159. RA Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M., RA Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.; RT "Normalization and subtraction of cap-trapper-selected cDNAs to prepare RT full-length cDNA libraries for rapid discovery of new genes"; RL Genome Res. 10(10):1617-1630(2000). XX RN [8] RX DOI; 10.1101/gr.152600. RX PUBMED; 11076861. RA Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P., RA Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N., RA Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R., RA Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S., RA Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y., RA Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y., RA Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.; RT "RIKEN integrated sequence analysis (RISA) system--384-format sequencing RT pipeline with 384 multicapillary sequencer"; RL Genome Res. 10(11):1757-1771(2000). XX DR MD5; cfeb114c61a880d5602dca73123f4116. XX FH Key Location/Qualifiers FH FT source 1..425 FT /organism="Mus musculus" FT /strain="C57BL/6J" FT /mol_type="mRNA" FT /dev_stage="16 days embryo" FT /clone_lib="RIKEN full-length enriched mouse cDNA library" FT /clone="C130075N06" FT /tissue_type="head" FT /db_xref="taxon:10090" FT CDS AK140936.1:<1..425 FT /codon_start=3 FT /transl_table=1 FT /note="lysosomal trafficking regulator (MGD|MGI:107448 FT GB|NM_010748, evidence: BLASTN, 100%, match=259)" FT /note="putative" FT /note="start codon is not identified" FT /db_xref="GOA:Q3US13" FT /db_xref="InterPro:IPR030464" FT /db_xref="MGI:MGI:107448" FT /db_xref="UniProtKB/TrEMBL:Q3US13" FT /protein_id="BAE24524.1" FT /translation="VGLLVQFAFRETREPVKEVTHPSPLSWIKGLKWGEYVGSPSAPVP FT VVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYNKEQGNVNHSEDQTGGLLEDLTV FT TSSPGLLPYLTSEVAQALEKSSLQNCGYLCKLGIKV" XX SQ Sequence 425 BP; 106 A; 100 C; 108 G; 111 T; 0 other; ttgttggctt gttagtccag ttcgctttca gagagacccg agaaccagtc aaggaagtca 60 ctcatccgag ccctttgtca tggataaaag gcttgaagtg gggggagtac gtaggttccc 120 ccagtgctcc agtacctgtg gtctgcttca gccagcccca tggagaaaga tttggttccc 180 tgcaggcact gcccaccaga gccatctgtg gtttatcacg aaacttctgt cttctgatga 240 cctacaacaa ggagcaaggt aatgtgaacc acagtgagga tcagacagga ggtctcttag 300 aagatctaac tgtcaccagc tcacctggac tgctgcctta tttgacttct gaagttgcac 360 aggctttgga gaaaagctct cttcagaatt gtggttactt atgcaagcta ggcattaaag 420 tgtag 425 //