ID   BAE24524; SV 1; linear; mRNA; HTC; MUS; 425 BP.
XX
PA   AK140936.1
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus (house mouse) hypothetical protein
XX
KW   CAP trapper; HTC; HTC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; cfeb114c61a880d5602dca73123f4116.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..425
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130075N06"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             AK140936.1:<1..425
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="lysosomal trafficking regulator (MGD|MGI:107448
FT                   GB|NM_010748, evidence: BLASTN, 100%, match=259)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3US13"
FT                   /db_xref="InterPro:IPR030464"
FT                   /db_xref="MGI:MGI:107448"
FT                   /db_xref="UniProtKB/TrEMBL:Q3US13"
FT                   /protein_id="BAE24524.1"
FT                   /translation="VGLLVQFAFRETREPVKEVTHPSPLSWIKGLKWGEYVGSPSAPVP
FT                   VVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYNKEQGNVNHSEDQTGGLLEDLTV
FT                   TSSPGLLPYLTSEVAQALEKSSLQNCGYLCKLGIKV"
XX
SQ   Sequence 425 BP; 106 A; 100 C; 108 G; 111 T; 0 other;
     ttgttggctt gttagtccag ttcgctttca gagagacccg agaaccagtc aaggaagtca        60
     ctcatccgag ccctttgtca tggataaaag gcttgaagtg gggggagtac gtaggttccc       120
     ccagtgctcc agtacctgtg gtctgcttca gccagcccca tggagaaaga tttggttccc       180
     tgcaggcact gcccaccaga gccatctgtg gtttatcacg aaacttctgt cttctgatga       240
     cctacaacaa ggagcaaggt aatgtgaacc acagtgagga tcagacagga ggtctcttag       300
     aagatctaac tgtcaccagc tcacctggac tgctgcctta tttgacttct gaagttgcac       360
     aggctttgga gaaaagctct cttcagaatt gtggttactt atgcaagcta ggcattaaag       420
     tgtag                                                                   425
//