ID CAB13698; SV 1; linear; genomic DNA; STD; PRO; 1269 BP.
XX
PA AL009126.3
XX
PR Project:PRJNA76;
XX
DT 18-JUL-2002 (Rel. 72, Created)
DT 20-JUN-2024 (Rel. 144, Last updated, Version 16)
XX
DE Bacillus subtilis subsp. subtilis str. 168 secreted endo-xylanase
XX
KW .
XX
OS Bacillus subtilis subsp. subtilis str. 168
OC Bacteria; Bacillota; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN [1]
RX DOI; 10.1038/36786.
RX PUBMED; 9384377.
RA Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V.,
RA Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R.,
RA Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S.,
RA Bruschi C.V., Caldwell B., Capuano V., Carter N.M., Choi S.K., Codani J.J.,
RA Connerton I.F., Cummings N.J., Daniel R.A., Denizot F., Devine K.M.,
RA Dusterhoft A., Ehrlich S.D., Emmerson P.T., Entian K.D., Errington J.,
RA Fabret C., Ferrari E., Foulger D., Fritz C., Fujita M., Fujita Y., Fuma S.,
RA Galizzi A., Galleron N., Ghim S.Y., Glaser P., Goffeau A., Golightly E.J.,
RA Grandi G., Guiseppi G., Guy B.J., Haga K., Haiech J., Harwood C.R.,
RA Henaut A., Hilbert H., Holsappel S., Hosono S., Hullo M.F., Itaya M.,
RA Jones L., Joris B., Karamata D., Kasahara Y., Klaerr-Blanchard M.,
RA Klein C., Kobayashi Y., Koetter P., Koningstein G., Krogh S., Kumano M.,
RA Kurita K., Lapidus A., Lardinois S., Lauber J., Lazarevic V., Lee S.M.,
RA Levine A., Liu H., Masuda S., Mauel C., Medigue C., Medina N.,
RA Mellado R.P., Mizuno M., Moestl D., Nakai S., Noback M., Noone D.,
RA O'Reilly M., Ogawa K., Ogiwara A., Oudega B., Park S.H., Parro V.,
RA Pohl T.M., Portetelle D., Porwollik S., Prescott A.M., Presecan E.,
RA Pujic P., Purnelle B., Rapoport G., Rey M., Reynolds S., Rieger M.,
RA Rivolta C., Rocha E., Roche B., Rose M., Sadaie Y., Sato T., Scanlan E.,
RA Schleich S., Schroeter R., Scoffone F., Sekiguchi J., Sekowska A.,
RA Seror S.J., Serror P., Shin B.S., Soldo B., Sorokin A., Tacconi E.,
RA Takagi T., Takahashi H., Takemaru K., Takeuchi M., Tamakoshi A., Tanaka T.,
RA Terpstra P., Tognoni A., Tosato V., Uchiyama S., Vandenbol M., Vannier F.,
RA Vassarotti A., Viari A., Wambutt R., Wedler E., Wedler H., Weitzenegger T.,
RA Winters P., Wipat A., Yamamoto H., Yamane K., Yasumoto K., Yata K.,
RA Yoshida K., Yoshikawa H.F., Zumstein E., Yoshikawa H., Danchin A.;
RT "The complete genome sequence of the gram-positive bacterium Bacillus
RT subtilis";
RL Nature 390(6657):249-256(1997).
XX
RN [2]
RA Barbe V., Cruveiller S., Kunst F., Lenoble P., Meurice G., Sekowska A.,
RA Vallenet D., Wang T., Moszer I., Medigue C., Danchin A.;
RT "From a consortium sequence to a unified sequence: the Bacillus subtilis
RT 168 reference genome a decade later";
RL Microbiology (Reading, Engl.) 155(Pt 6):1758-1775(2009).
XX
RN [3]
RX DOI; 10.1099/mic.0.064691-0.
RX PUBMED; 23429746.
RA Belda E., Sekowska A., Le Fevre F., Mornico D., Morgat A., Ouzounis C.,
RA Vallenet D., Medigue C., Danchin A.;
RT "An updated metabolic view of the Bacillus subtilis 168 genome";
RL Microbiology (Reading, Engl.) 159(Pt 4):757-770(2013).
XX
RN [4]
RA Kunst F., Ogasawara N., Yoshikawa H., Danchin A.;
RT ;
RL Submitted (18-NOV-1997) to the INSDC.
RL I. Moszer, A. Danchin, Genetique des Genomes Bacteriens, Institut Pasteur,
RL 28 rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL moszer@pasteur.fr, antoine.danchin@normalesup.org Phone: +33 (0)1 45 68 84
RL 41, Fax: +33 (0)1 45 68 89 48
XX
RN [5]
RG Institut Pasteur and Genoscope
RA Genoscope - C.E.A.;
RT ;
RL Submitted (29-JAN-2009) to the INSDC.
RL Genoscope - Centre National de Sequencage: BP 191 91006 EVRY cedex - FRANCE
RL (E-mail: seqref@genoscope.cns.fr - Web: www.genoscope.cns.fr)
XX
RN [6]
RG AMAbiotics and Genoscope
RA Genoscope - C.E.A.;
RT ;
RL Submitted (24-JAN-2013) to the INSDC.
RL A. Danchin, AMAbiotics, Bldg G1, 2, rue Gaston Cremieux, 91000 EVRY
RL antoine.danchin@normalesup.org Bldg G1 Genoscope / CEA (Commissariat a
RL l'energie atomique et aux energies alternatives): BP 191 91006 EVRY cedex -
RL FRANCE (E-mail: seqref@genoscope.cns.fr - Web: www.genoscope.cns.fr)
XX
RN [8]
RX PUBMED; 29280348.
RX DOI; https://doi.org/10.1111/1751-7915.13043.
RA Borriss R., Danchin A., Harwood C.R., Medigue C., Rocha E.P.C.,
RA Sekowska A., Vallenet D.;
RT "Bacillus subtilis, the model Gram-positive bacterium: 20 years of
RT annotation refinement";
RL Microb Biotechnol 11(1):3-17(2018).
XX
RN [9]
RX DOI; 10.1111/1751-7915.14257.
RX PUBMED; 37002859.
RA Bremer E., Calteau A., Danchin A., Harwood C., Helmann J.D., Medigue C.,
RA Palsson B.O., Sekowska A., Vallenet D., Zuniga A., Zuniga C.;
RT "A model industrial workhorse: Bacillus subtilis strain 168 and its genome
RT after a quarter of a century";
RL Microb Biotechnol 00:1-29(2023).
XX
DR MD5; a653840a1119baa10f6d5f9792419e9a.
DR BioSample; SAMEA3138188.
XX
FH Key Location/Qualifiers
FH
FT source 1..1269
FT /organism="Bacillus subtilis subsp. subtilis str. 168"
FT /chromosome="1"
FT /strain="168"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:224308"
FT CDS complement(AL009126.3:1942714..1943982)
FT /codon_start=1
FT /transl_table=11
FT /gene="xynC"
FT /locus_tag="BSU_18150"
FT /old_locus_tag="BSU18150"
FT /product="secreted endo-xylanase"
FT /function="16.11: Scavenge (Catabolism)"
FT /EC_number="3.2.1.136"
FT /note="Evidence 1a: Function from experimental evidences in
FT the studied strain; PubMedId: 17028274, 24271172, 25355936,
FT 26559526, 28330222, 29634785, 34361682, 34557520; Product
FT type e: enzyme"
FT /experiment="publication(s) with functional evidences,
FT PMID:17028274, 24271172, 25355936, 26559526, 28330222,
FT 29634785, 34361682, 34557520"
FT /protein_id="CAB13698.1"
FT /translation="MIPRIKKTICVLLVCFTMLSVMLGPGATEVLAASDVTVNVSAEKQ
FT VIRGFGGMNHPAWAGDLTAAQRETAFGNGQNQLGFSILRIHVDENRNNWYKEVETAKSA
FT VKHGAIVFASPWNPPSDMVETFNRNGDTSAKRLKYNKYAAYAQHLNDFVTFMKNNGVNL
FT YAISVQNEPDYAHEWTWWTPQEILRFMRENAGSINARVIAPESFQYLKNLSDPILNDPQ
FT ALANMDILGTHLYGTQVSQFPYPLFKQKGAGKDLWMTEVYYPNSDTNSADRWPEALDVS
FT QHIHNAMVEGDFQAYVWWYIRRSYGPMKEDGTISKRGYNMAHFSKFVRPGYVRIDATKN
FT PNANVYVSAYKGDNKVVIVAINKSNTGVNQNFVLQNGSASNVSRWITSSSSNLQPGTNL
FT TVSGNHFWAHLPAQSVTTFVVNR"
XX
SQ Sequence 1269 BP; 378 A; 262 C; 299 G; 330 T; 0 other;
atgattccac gcataaaaaa aacaatttgt gtactattag tatgtttcac tatgctgtca 60
gtcatgttag ggccaggcgc tactgaagtt ttggcagcaa gtgatgtaac agttaatgta 120
tctgcagaga aacaagtgat tcgcggtttt ggagggatga atcatccggc ttgggctggg 180
gatcttacag cagctcaaag agaaactgct tttggcaatg gacagaacca gttaggattt 240
tcaatcttaa gaattcatgt agatgaaaat cgaaataatt ggtataaaga ggtggagact 300
gcaaagagtg cggtcaaaca cggagcaatc gtttttgctt ctccttggaa tcctccaagt 360
gatatggttg agacctttaa tcggaatggt gacacatcgg ctaaacggct gaaatacaac 420
aagtacgcag catacgcgca gcatcttaac gattttgtta ccttcatgaa gaataatggt 480
gtgaatcttt acgcgatttc ggtccaaaac gagcctgatt acgctcacga gtggacgtgg 540
tggacgccgc aagaaatact tcgctttatg agagaaaacg ccggctcgat caatgcccgc 600
gtcattgcgc ctgagtcatt tcaatacttg aagaatttgt cggacccgat cttgaacgat 660
ccgcaggctc ttgccaatat ggatattctc ggaactcacc tgtacggcac ccaggtcagc 720
caattccctt atcctctttt caaacaaaaa ggagcgggga aggacctttg gatgacggaa 780
gtatactatc caaacagtga taccaactcg gcggatcgat ggcctgaggc attggatgtt 840
tcacagcata ttcacaatgc gatggtagag ggggactttc aagcttatgt atggtggtac 900
atccgaagat catatggacc tatgaaagaa gatggtacga tcagcaaacg cggctacaat 960
atggctcatt tctcaaagtt tgtgcgtccc ggctatgtaa ggattgatgc aacgaaaaac 1020
cctaatgcga acgtttacgt gtcagcctat aaaggtgaca acaaggtcgt tattgttgcc 1080
atcaataaaa gcaacacagg agtcaaccaa aactttgttt tgcagaatgg atctgcttca 1140
aacgtatcta gatggatcac gagcagcagc agcaatctac aacctggaac gaatctcact 1200
gtatcaggca atcatttttg ggctcatctt ccagctcaaa gcgtgacaac atttgttgta 1260
aatcgttaa 1269
//