ID CAE82047; SV 1; linear; genomic DNA; STD; HUM; 100 BP. XX PA X14358.1 XX DT 16-FEB-1989 (Rel. 18, Created) DT 18-APR-2005 (Rel. 83, Last updated, Version 3) XX DE Homo sapiens (human) hypothetical protein XX KW . XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RA Hourcade D.; RT ; RL Submitted (29-NOV-1988) to the INSDC. RL Hourcade D., Howard Hughes Medical Institute, 660 S. Euclid St. Louis Mo, RL 63110, USA. XX RN [2] RX DOI; 10.1084/jem.168.4.1255. RX PUBMED; 2971757. RA Hourcade D., Miesner D.R., Atkinson J.P., Holers V.M.; RT "Identification of an alternative polyadenylation site in the human C3b/C4b RT receptor (complement receptor type 1) transcriptional unit and prediction RT of a secreted form of complement receptor type 1"; RL J. Exp. Med. 168(4):1255-1270(1988). XX DR MD5; 40accff6ebd64a7793a67a30bf9d7f30. XX FH Key Location/Qualifiers FH FT source 1..100 FT /organism="Homo sapiens" FT /chromosome="1q32." FT /mol_type="genomic DNA" FT /clone_lib="lambda Charon 4A (ATCC 37333)." FT /clone="lambda gen1.4" FT /tissue_type="fetal liver" FT /db_xref="taxon:9606" FT CDS X14358.1:<18..>117 FT /codon_start=3 FT /note="CR1 receptor SCR9 (18 is 2nd base in codon) (117 is FT 2nd base in codon)" FT /db_xref="InterPro:IPR000436" FT /db_xref="InterPro:IPR035976" FT /db_xref="UniProtKB/TrEMBL:Q16521" FT /protein_id="CAE82047.1" FT /translation="KSCKTPPDPVNGMVHVITDIHVGSRINYSCTTG" XX SQ Sequence 100 BP; 31 A; 22 C; 20 G; 27 T; 0 other; gtaaatcatg taaaactcct ccagatccag tgaatggcat ggtgcatgtg atcacagaca 60 tccatgttgg atccagaatc aactattctt gtactacagg 100 //