ID CBE70083; SV 1; linear; genomic DNA; STD; ENV; 1674 BP. XX PA FP565575.1 XX PR Project:PRJNA40373; XX DT 16-SEP-2009 (Rel. 102, Created) DT 27-FEB-2015 (Rel. 123, Last updated, Version 10) XX DE Candidatus Methylomirabilis oxyfera putative Multi-sensor signal DE transduction histidine kinase precursor XX KW . XX OS Candidatus Methylomirabilis oxyfera OC Bacteria; candidate division NC10; Candidatus Methylomirabilis. XX RN [1] RA Genoscope - CEA; RT ; RL Submitted (15-SEP-2009) to the INSDC. RL Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex - RL FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr). XX RN [2] RX DOI; 10.1038/nature08883. RX PUBMED; 20336137. RA Ettwig K.F., Butler M.K., Le Paslier D., Pelletier E., Mangenot S., RA Kuypers M.M.M., Schreiber F., Dutilh B.E., Zedelius J., de Beer D., RA Gloerich J., Wessels H.J.C.T., van Allen T., Luesken F., Wu M., RA van de Pas-Schoonen K.T., Op den Camp H.J.M., Janssen-Megens E.M., RA Francoijs K-J., Stunnenberg H., Weissenbach J., Jetten M.S.M., Strous M.; RT "Nitrite-driven anaerobic methane oxidation by oxygenic bacteria"; RL Nature 464(7288):543-548(2010). XX DR MD5; 9b20838e095e6440c4c3b79730c4c921. DR BioSample; SAMEA3138294. XX FH Key Location/Qualifiers FH FT source 1..1674 FT /organism="Candidatus Methylomirabilis oxyfera" FT /environmental_sample FT /mol_type="genomic DNA" FT /lat_lon="52.17 N 6.41 E" FT /collection_date="06-Jul-2006" FT /db_xref="taxon:671143" FT CDS complement(FP565575.1:2601682..2603355) FT /transl_table=11 FT /locus_tag="DAMO_3010" FT /product="putative Multi-sensor signal transduction FT histidine kinase precursor" FT /note="Evidence 3 : Function proposed based on presence of FT conserved amino acid motif, structural feature or limited FT homology" FT /db_xref="GOA:D5MMG1" FT /db_xref="InterPro:IPR000014" FT /db_xref="InterPro:IPR000700" FT /db_xref="InterPro:IPR001610" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR013656" FT /db_xref="InterPro:IPR035965" FT /db_xref="InterPro:IPR036097" FT /db_xref="InterPro:IPR036890" FT /db_xref="UniProtKB/TrEMBL:D5MMG1" FT /inference="ab initio prediction:AMIGene:2.0" FT /protein_id="CBE70083.1" FT /translation="MTDTNEPASEDVALGRQIKWLIGLRLLVAFLFLGSAGILAIREHP FT PFTLTPLFVLIACACLLTVLYSILLNRTMRLRQLCSLQLWIDAVLATALVHYTGGIKSV FT FAFVYIFPVLAASVLLSRRSSLLLASAGTILYGALINIQIYGLTEETPFLFTGSTTHDP FT AYALLQFSVNSATFFLVALLGSQLAERLKETGRELEAQRIDLRNLRTLHEDIVENIPSG FT VITLDLTGKIVSFNRGAQKIIGIAVEQIRDKNWRETPFGAIKELEVFFSTPTSAFAGCS FT QELPIRGLDGHPIPVGINLTPLKSSEGRLIGLVGIFQDLTERRKTEARLRQADRLATAG FT QLAAGLAHEVRNPLAAISGCIELIKEAGTARPQLLDIVLREAERLKLVTGQFLDFAKPT FT LASQKQCNLVALVAEAVSLLEKSCDSAHPVTFSIQREAEEVMAAGDPDQLKQALWNLGL FT NAIQAMQMGGRLSFVIRRHGSENGDNWVGIELTDTGQGIPPEEVERIFDPFYTTKPGGT FT GLGLTITQKIIDNLGGRIEVISREGGGSTFRVLLKQAPDE" XX SQ Sequence 1674 BP; 360 A; 486 C; 478 G; 350 T; 0 other; atgacggaca caaacgagcc tgcgtctgaa gacgttgcgc tgggccgaca gatcaaatgg 60 ctgatcggtc tccggctcct cgtggcgttc ctgtttttgg gctcagccgg tattcttgct 120 atccgggagc acccgccctt tacgctgacc cccctctttg tcttaatcgc ctgcgcctgc 180 cttctcaccg tcctctattc gatcttactg aaccgtacta tgcgactgag gcagctctgc 240 agcctgcagc tctggatcga cgcggtcctg gctaccgccc tggtacacta taccggtggg 300 atcaagagtg tctttgcgtt tgtctacatc tttcccgtcc tggccgcatc cgtgctccta 360 tccaggcgat cgagcctgtt actcgcaagc gccggcacca tactgtacgg agcgctgatc 420 aatattcaga tctatgggct cacggaggag acgccgttcc tctttacggg aagcaccacg 480 catgaccccg catacgcgct cctccagttc tccgtcaata gtgcgacctt ttttcttgtg 540 gcgctcctag gcagtcaact tgccgagcgg ctcaaagaaa cgggccgcga actggaagcg 600 caacggatcg acctccgcaa tctccggacc cttcacgagg acattgttga aaatatccca 660 agcggggtca taacgctgga cctcactgga aagatcgtat cgttcaaccg gggggcgcag 720 aagatcatcg gcattgcggt agagcagata cgagacaaga actggcgaga gacccctttt 780 ggagcgatta aggagcttga ggtattcttc tccaccccca cgtctgcctt tgccggatgc 840 tcccaagagc ttccgatccg aggcctagac ggccatccga tcccggttgg gatcaacctg 900 acacccctga agtcatcaga aggcagactt ataggccttg tgggcatctt tcaggatctg 960 acggagcgga gaaagacaga ggccaggctc cgtcaagccg accggttagc gacggcgggc 1020 caactggcag ccggactggc gcatgaagtg aggaatcctc tggccgcgat aagcggttgc 1080 atcgaactga taaaggaagc gggaacagcc agacctcaac tgctcgatat cgttcttcgc 1140 gaggccgagc gactcaagct ggtaaccgga cagttcttgg atttcgcgaa gccgaccctg 1200 gcctcacaga agcagtgcaa cctcgtcgcg ctggttgcag aggcggtctc gctcttggaa 1260 aagagctgcg acagcgctca cccggtgacc ttttccattc agcgtgaggc cgaggaggtc 1320 atggctgcag gcgaccccga tcagctaaaa caggcgctgt ggaatcttgg gctcaacgcg 1380 atccaggcta tgcagatggg cggtcggctc agctttgtta tccgacgtca cggatctgaa 1440 aacggcgata actgggtggg gatagagctg accgacaccg gacaaggaat cccgccggag 1500 gaggtcgaac gaatttttga tccattctat acgacgaagc ctggcggtac aggcctgggg 1560 ctgaccatca cacagaagat catcgataat ctcggcggcc ggatcgaggt gatcagtcgg 1620 gaaggtggcg ggtcaacctt tcgcgtcttg ctcaaacagg ctccggatga atag 1674 //