ID DQ986547; SV 1; linear; genomic DNA; STD; INV; 527 BP. XX AC DQ986547; XX DT 01-JUN-2008 (Rel. 96, Created) DT 01-JUN-2008 (Rel. 96, Last updated, Version 1) XX DE Bulla occidentalis voucher BMNH 20030340 cytochrome oxidase subunit I (COI) DE gene, partial cds; mitochondrial. XX KW . XX OS Bulla occidentalis OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; OC Heterobranchia; Euthyneura; Euopisthobranchia; Cephalaspidea; Bulloidea; OC Bullidae; Bulla. OG Mitochondrion XX RN [1] RP 1-527 RA Malaquias M.A.E., Reid D.G.; RT "Systematic revision of the living species of Bullidae (Mollusca: RT Gastropoda: Cephalaspidea), with a molecular phylogenetic analysis"; RL Zool. J. Linn. Soc. 153(3):453-543(2008). XX RN [2] RP 1-527 RA Malaquias M.A.E., Reid D.G.; RT "Speciation and historical biogeography of bubble-shells (Mollusca, RT Gastropoda)"; RL Unpublished. XX RN [3] RP 1-527 RA Malaquias M.A.E., Reid D.G.; RT ; RL Submitted (06-SEP-2006) to the INSDC. RL Zoology, Natural History Museum, Cromwell Road, London SW7 5BD, UK XX DR MD5; 4bb7e594b091d1de257054970f6f4446. XX FH Key Location/Qualifiers FH FT source 1..527 FT /organism="Bulla occidentalis" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="BMNH 20030340" FT /db_xref="taxon:413680" FT gene complement(<1..>527) FT /gene="COI" FT CDS complement(<1..>527) FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:B3EZ01" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:B3EZ01" FT /protein_id="ABM65068.1" FT /translation="IRFELGTASAFLGDDHFYNVIVTAHAFVMIFFMVMPLMIGGFGNW FT MVPLLIGAPDMSFPRMNNMSFWLLPPSFILLLVSSMIEGGAGTGWTVYPPLSGPIAHGS FT TSVDLVIFSLHLAGMSSILGAINFITTIINMRSPGITFERLSLFVWSVFVTAFLLLLSL FT PVLAGAITMLLT" XX SQ Sequence 527 BP; 187 A; 115 C; 109 G; 116 T; 0 other; tcagttaaga gcatagtgat agccccagct aaaacaggta atgataatag aagcaagaaa 60 gcagttacga acactgatca cacgaacagg ctcaaccgtt cgaaggtgat ccccggagat 120 cgcatattaa tgatcgttgt aataaaatta atagcaccaa gaatagacga catccctgct 180 aaatggagcg aaaaaattac taggtccact gatgttgacc catgagcaat tggccctgac 240 agaggtggat atactgtcca cccggtcccg gctcctccct cgatcatcct tgatacaagt 300 aataaaataa aagagggagg aagaagtcag aaacttatgt tattcattcg agggaacctt 360 atgtcgggag ccccgattaa taaagggact atccagttcc cgaaccctcc aatcatcaga 420 ggcattacca taaaaaaaat cattacaaat gcatgagcag taacaatgac gttataaaaa 480 tgatcatctc ctaagaaggc tgaagcggtt cctagctcga atcgaat 527 //