ID EF449528; SV 1; linear; genomic DNA; STD; INV; 328 BP. XX AC EF449528; XX DT 28-JUN-2007 (Rel. 92, Created) DT 28-JUN-2007 (Rel. 92, Last updated, Version 1) XX DE Achaearanea acoreensis histone H3 (H3) gene, partial cds. XX KW . XX OS Cryptachaea blattea OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Chelicerata; Arachnida; Araneae; OC Araneomorphae; Entelegynae; Araneoidea; Theridiidae; Cryptachaea. XX RN [1] RP 1-328 RA Arnedo M.A., Agnarsson I., Gillespie R.G.; RT "Molecular insights into the phylogenetic structure of the spider genus RT Theridion (Araneae, Theridiidae) and the origin of the Hawaiian RT Theridion-like fauna"; RL Zool. Scr. 36(4):337-352(2007). XX RN [2] RP 1-328 RA Arnedo M.A., Agnarsson I., Gillespie R.G.; RT ; RL Submitted (20-FEB-2007) to the INSDC. RL Animal Biology, Universitat de Barcelona, Av. Diagonal 645, Barcelona, RL Catalonia 08028, Spain XX DR MD5; 06a1e58bc7eb92c6c058704ce17ea562. XX FH Key Location/Qualifiers FH FT source 1..328 FT /organism="Cryptachaea blattea" FT /mol_type="genomic DNA" FT /country="USA:HI, Kauai, Mohihi Rd., Kohua Tr. head" FT /specimen_voucher="MS92" FT /db_xref="taxon:585892" FT gene <1..>328 FT /gene="H3" FT mRNA <1..>328 FT /gene="H3" FT /product="histone H3" FT CDS <1..>328 FT /codon_start=2 FT /gene="H3" FT /product="histone H3" FT /db_xref="GOA:A6MTW2" FT /db_xref="InterPro:IPR000164" FT /db_xref="InterPro:IPR007125" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A6MTW2" FT /protein_id="ABR23228.1" FT /translation="RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIR FT RYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCA FT IHAKR" XX SQ Sequence 328 BP; 89 A; 88 C; 77 G; 74 T; 0 other; tcgtaaaagt accggaggca aagctccccg aaagcaactg gccaccaagg cagctcgtaa 60 gagcgcccct gcaaccggag gtgttaagaa accacatcgt tacaggcctg gaacagtcgc 120 tttgagagaa atccgtcgtt atcaaaaatc aactgagctc ctcatccgta agttgccctt 180 ccaacgttta gtgagagaaa tcgctcagga tttcaagacc gacttgcgtt tccagagctc 240 tgctgtcatg gctcttcaag aggctagcga agcttacttg gttggtcttt tcgaagacac 300 taacctttgc gctatccacg ccaagaga 328 //