ID KF682684; SV 1; linear; genomic DNA; STD; INV; 378 BP. XX AC KF682684; XX DT 27-JAN-2014 (Rel. 119, Created) DT 15-MAY-2014 (Rel. 120, Last updated, Version 3) XX DE Panopeidae gen. n. sp. n. nr. Acantholobulus schmitti ULLZ 8646 enolase DE gene, partial cds. XX KW . XX OS Panopeidae gen. n. sp. n. nr. Acantholobulus schmitti ULLZ 8646 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Malacostraca; Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura; OC Eubrachyura; Xanthoidea; Panopeidae; unclassified Panopeidae. XX RN [1] RP 1-378 RA Thoma B.P., Guinot D., Felder D.L.; RT "Evolutionary relationships among American mud crabs (Crustacea: Decapoda: RT Brachyura: Xanthoidea) inferred from nuclear and mitochondrial markers, RT with comments on adult morphology"; RL Zool. J. Linn. Soc. 170(1):86-109(2014). XX RN [2] RP 1-378 RA Thoma B.P., Guinot D., Felder D.L.; RT ; RL Submitted (13-SEP-2013) to the INSDC. RL Department of Biology and Laboratory for Crustacean Research, University of RL Louisiana at Lafayette, 300 East St. Mary Blvd., Lafayette, LA 70503, USA XX DR MD5; d3232361ee8af0d5d122b5f48e7b847c. XX CC ##Assembly-Data-START## CC Assembly Method :: Sequencher v. 5.10 CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..378 FT /organism="Panopeidae gen. n. sp. n. nr. Acantholobulus FT schmitti ULLZ 8646" FT /mol_type="genomic DNA" FT /country="USA" FT /isolation_source="Texas, South Padre Island Jetty" FT /specimen_voucher="ULLZ 8646" FT /identified_by="Darryl L. Felder" FT /db_xref="taxon:1450301" FT mRNA <1..>378 FT /product="enolase" FT CDS <1..>378 FT /codon_start=1 FT /product="enolase" FT /db_xref="GOA:W5RYF4" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:W5RYF4" FT /protein_id="AHG95516.1" FT /translation="MILPTGASSFTEAMRMGSEVYHHLKAVIKARFGLDXTAVGDEGGF FT APNILNNKDALDLIQEAIKKAGYTGKIEIGMDVAASEFYKGNNVYDLDFKTANNDGSQK FT ISGDQLRDMYMEFCKDFPIVSI" XX SQ Sequence 378 BP; 100 A; 78 C; 91 G; 103 T; 6 other; atgatcctgc ccactggtgc aagtagcttt actgaagcca tgcgcatggg cagtgaggtm 60 taccatcact tgaaggctgt cattaaggca cgctttggcc ttgatrcyac tgctgtgggt 120 gatgaaggag gctttgcacc caacattctt aacaacaagg atgctctgga ccttatccaa 180 gaggccatta agaaggctgg ttacacaggc aagattgaaa ttggaatgga tgtggctgca 240 tctgaattct acaagggcaa taatgtctat gaccttgact tcaagactgc taataatgat 300 ggttctcara aratctctgg tgaccagctc agggacatgt ayatggaatt ctgtaaggac 360 ttccccattg tttctatt 378 //