ID KR140159; SV 1; linear; genomic DNA; STD; INV; 133 BP. XX AC KR140159; XX DT 26-SEP-2015 (Rel. 126, Created) DT 23-JUN-2016 (Rel. 129, Last updated, Version 3) XX DE Aphelagathis wendymooreae voucher H14988 cytochrome c oxidase subunit I DE (COI) gene, partial cds; mitochondrial. XX KW . XX OS Aphelagathis wendymooreae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Hymenoptera; Apocrita; Parasitoida; Ichneumonoidea; OC Braconidae; Agathidinae; Aphelagathis. OG Mitochondrion XX RN [1] RP 1-133 RX DOI; 10.11646/zootaxa.4000.1.3. RX PUBMED; 26623602. RA Sharkey M.J., Chapman E.G., Janzen D.H., Hallwachs W., Smith M.A.; RT "Revision of Aphelagathis (Hymenoptera, Braconidae, Agathidinae, RT Agathidini)"; RL Zootaxa 4000(1):73-89(2015). XX RN [2] RP 1-133 RA Chapman E.G., Sharkey M.J.; RT ; RL Submitted (17-APR-2015) to the INSDC. RL Entomology, University of Kentucky, S-225 Agricultural Science Center RL North, Lexington, KY 40546, USA XX DR MD5; 134bc0deb266198bc18676fc7852e682. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..133 FT /organism="Aphelagathis wendymooreae" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="USA" FT /lat_lon="31.633 N 110.65 W" FT /specimen_voucher="H14988" FT /collected_by="Eric E Grissell" FT /collection_date="30-Jul-2013" FT /identified_by="Mike Sharkey" FT /db_xref="taxon:1708976" FT gene <1..>133 FT /gene="COI" FT CDS <1..>133 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome c oxidase subunit I" FT /db_xref="GOA:A0A0M4F9I0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0M4F9I0" FT /protein_id="ALC74369.1" FT /translation="ILYFIFGIWSGMLGLSMSLIIRMELSITSNFIGNDQIYNSIVXA" XX SQ Sequence 133 BP; 45 A; 8 C; 18 G; 61 T; 1 other; aattttatat tttatttttg gaatttgatc tggtatatta ggtttatcaa taagtttaat 60 tattcgaata gagttaagaa ttacaagaaa ttttattggt aatgatcaaa tttataattc 120 aattgttnct gct 133 //