ID KT601564; SV 1; linear; genomic DNA; STD; VRT; 288 BP. XX AC KT601564; XX DT 11-DEC-2015 (Rel. 127, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 3) XX DE Hemidactylus yajurvedi isolate CES12006 cytochrome b gene, partial cds; DE mitochondrial. XX KW . XX OS Hemidactylus yajurvedi (Kanker rock gecko) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Online-Only RP 1-288 RX DOI; 10.11646/zootaxa.4021.2.5. RX PUBMED; 26624132. RA Murthy B.H., Bauer A., Lajmi A., Agarwal I., Giri V.B.; RT "A new rock dwelling Hemidactylus (Squamata: Gekkonidae) from Chhattisgarh, RT India"; RL Zootaxa 4021(2):334-350(2015). XX RN [2] RP 1-288 RA Murthy B.H.C.K., Bauer A., Lajmi A., Agarwal I., Giri V.B.; RT ; RL Submitted (31-AUG-2015) to the INSDC. RL Centre for Ecological Sciences, Indian Institute of Science, C.V. Raman RL Road, Bangalore, Karnataka 560012, India XX DR MD5; 25ad7ab04285a942336a9a16812ea236. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..288 FT /organism="Hemidactylus yajurvedi" FT /organelle="mitochondrion" FT /isolate="CES12006" FT /mol_type="genomic DNA" FT /db_xref="taxon:1766037" FT CDS <1..>288 FT /codon_start=1 FT /transl_table=2 FT /product="cytochrome b" FT /db_xref="GOA:A0A0S3J2T8" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:A0A0S3J2T8" FT /protein_id="ALR72596.1" FT /translation="FGSLLGLCLITQITTGLFLAMHYTADTTLAFTSIAHICRDVQYGW FT LIRNTHANGASMFFICLYLHIGRGVYYGSYLYKETWNTGIIMLFLTMATAF" XX SQ Sequence 288 BP; 88 A; 84 C; 46 G; 70 T; 0 other; ttcggctcat tactcgggct atgtctaatc acacaaatta ccaccggcct gttcctagca 60 atacactaca ctgccgacac aacactagct tttacctcaa tcgcccacat ctgtcgagat 120 gtacagtacg gctgattaat ccgaaacacc cacgccaacg gcgcatcaat attcttcatc 180 tgtctatacc tgcacatcgg acgaggagta tactacgggt catacctata caaagagaca 240 tgaaacacag gaattattat actattccta acaatagcca cagcgttc 288 //