ID KU870887; SV 1; linear; genomic DNA; STD; INV; 555 BP. XX AC KU870887; XX DT 29-SEP-2016 (Rel. 130, Created) DT 11-JUN-2017 (Rel. 133, Last updated, Version 2) XX DE Epimeria rimicarinata isolate M24 cytochrome c oxidase subunit I (COI) DE gene, partial cds; mitochondrial. XX KW . XX OS Epimeria rimicarinata OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Malacostraca; Eumalacostraca; Peracarida; Amphipoda; Amphilochidea; OC Amphilochida; Amphilochidira; Iphimedioidea; Epimeriidae; Epimeria. OG Mitochondrion XX RN [1] RP 1-555 RA Verheye M.L., Backeljau T., d'Udekem d'Acoz C.; RT "Looking beneath the tip of the iceberg: diversification of the genus RT Epimeria on the Antarctic shelf (Crustacea, Amphipoda)"; RL Polar Biol. 39:925-945(2016). XX RN [2] RP 1-555 RA Verheye M.L., Backeljau T., d'Udekem d'Acoz C.; RT ; RL Submitted (04-MAR-2016) to the INSDC. RL OD Taxonomy and Phylogeny, Institut Royal des Sciences Naturelles de RL Belgique, Rue Vautier 29, Bruxelles 1000, Belgique XX DR MD5; 1e6af70ec1fe118a6cda024dd5f54e2e. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..555 FT /organism="Epimeria rimicarinata" FT /organelle="mitochondrion" FT /isolate="M24" FT /mol_type="genomic DNA" FT /country="Antarctica:Prydz Bay" FT /specimen_voucher="MNHN:IU:2014-4265" FT /db_xref="taxon:588413" FT gene <1..>555 FT /gene="COI" FT CDS <1..>555 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome c oxidase subunit I" FT /EC_number="1.9.3.1" FT /db_xref="GOA:A0A1C9UKS7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A1C9UKS7" FT /protein_id="AOR57227.1" FT /translation="YILILPAFGVFSHIVSQEAGKKEVFGALGMIYAMSAIGJLGFIVW FT AHHMFTVGMDVDTRAYFTSATMIIAVPTGIKVFSWLGTIQGGSLRHTPSLAWALGFIFL FT FTVGGLTGVMLANSSIDIILHDTYYVVAHFHYVLSMGAVFGIFAGLAHWFPLFTGLTLN FT PYLAMAHFYTMFTGVNLTFFPQ" XX SQ Sequence 555 BP; 148 A; 113 C; 101 G; 190 T; 3 other; tatattttaa tcytgccggc cttcggcgta ttttctcata ttgttagaca agaagcagga 60 aaaaaagagg tmtttggagc attaggtata atttacgcta tatccgcaat tggamtccta 120 ggctttattg tttgagctca tcatatattc acagtgggta tagatgtaga cacacgggcg 180 tacttcactt ctgccacaat aattatcgca gttcctacag gcattaaagt tttcagatgg 240 ttaggcacaa tccaaggggg tagactccgg cacacccctt ctcttgcctg agcattaggc 300 tttatcttct tatttacagt agggggctta acaggagtaa tattagccaa ctcgtctatt 360 gatattatcc ttcacgatac ctactacgtg gtagctcatt tccattatgt cctatcaata 420 ggagcagtat ttggtatctt tgcaggacta gctcattgat ttcctttatt tacaggttta 480 actttaaacc cgtatttagc aatagcccat ttttatacta tatttacagg tgtaaactta 540 actttcttcc ctcaa 555 //