ID KY962773; SV 1; linear; genomic DNA; STD; VRT; 592 BP. XX AC KY962773; XX DT 20-DEC-2017 (Rel. 135, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 5) XX DE Pristimantis bounides voucher NMP6V75066 recombination activating protein 1 DE (RAG1) gene, partial cds. XX KW . XX OS Pristimantis bounides (hill dweller rubber frog) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Anura; Neobatrachia; Hyloidea; Strabomantidae; Pristimantis. XX RN [1] RC Publication Status: Online-Only RP 1-592 RX PUBMED; 29187793. RA Lehr E., von May R., Moravec J., Cusi J.C.; RT "A new species of Phrynopus (Amphibia, Anura, Craugastoridae) from upper RT montane forests and high Andean grasslands of the Pui Pui Protected Forest RT in central Peru"; RL J. Anim. Genet. Zookeys(713):131-157(2017). XX RN [2] RP 1-592 RA von May R., Lehr E.; RT ; RL Submitted (17-APR-2017) to the INSDC. RL Ecology and Evolutionary Biology, University of Michigan, 2051 Ruthven RL Museums Building, 1109 Geddes Ave., Ann Arbor, MI 48109, USA XX DR MD5; ac2ca1b1c4047baf924c76f5043be48c. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..592 FT /organism="Pristimantis bounides" FT /mol_type="genomic DNA" FT /country="Peru:Junin, Sector Carrizal, Carrtera FT Satipo-Toldopampa, km 134" FT /lat_lon="11.48 S 74.89 W" FT /specimen_voucher="NMP6V75066" FT /collected_by="E. Lehr, J. Moravec, J.C. Cusi" FT /collection_date="23-Jun-2013" FT /db_xref="taxon:2058353" FT /altitude="3350m" FT /type_material="paratype of Pristimantis bounides" FT gene <1..>592 FT /gene="RAG1" FT mRNA <1..>592 FT /gene="RAG1" FT /product="recombination activating protein 1" FT CDS <1..>592 FT /codon_start=1 FT /gene="RAG1" FT /product="recombination activating protein 1" FT /db_xref="GOA:A0A2H4W8I1" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR017907" FT /db_xref="InterPro:IPR018957" FT /db_xref="InterPro:IPR019485" FT /db_xref="InterPro:IPR024627" FT /db_xref="InterPro:IPR035714" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:A0A2H4W8I1" FT /protein_id="AUC63241.1" FT /translation="FPRNNAVEWKPHCSKCDVCSSSKNWSKRKTTLHQNCLIKKRKLNV FT EHRKKNKSGKMSPLWKKTRTLNQIRNKCKQIHLDSNLLVVDYPSDFTKSFTCQVCEHIL FT SDPVQTSCKHLFCRICILKYFKIMGCYCPSCRHTCFPTDLAPPVKSFLNILNSLVLKCA FT VTGCDEEILLGKYSQHIAKHKEIKGKDAYAPINK" XX SQ Sequence 592 BP; 193 A; 130 C; 114 G; 154 T; 1 other; tttccccgta acaatgcggt ggagtggaag cctcactgtt ccaaatgtga tgtttgcagt 60 tcctccaaaa attggagtaa gagaaagaca acattgcacc aaaaytgtct tatcaaaaag 120 aggaaactca atgtggaaca tagaaagaaa aacaaaagtg gaaaaatgtc ccctctctgg 180 aagaagacta ggaccctgaa tcaaatcagg aacaagtgca aacaaatcca ccttgattcc 240 aacttactgg ttgttgacta tccttccgat tttacgaagt cgttcacatg ccaggtgtgt 300 gagcacatat tgtctgatcc agtgcaaacc tcatgcaaac atttgttctg caggatttgc 360 atcctcaaat atttcaagat tatgggttgc tactgcccat cttgcagaca cacttgcttc 420 ccaacggatc tggcaccacc cgtgaagtca tttcttaaca ttttaaactc cttggtctta 480 aagtgcgcag tgactggatg tgatgaggaa atcctgcttg gaaaatactc ccaacatatt 540 gctaaacata aagaaatcaa aggtaaagat gcttatgccc ctatcaacaa ag 592 //