ID KY962776; SV 1; linear; genomic DNA; STD; VRT; 622 BP. XX AC KY962776; XX DT 20-DEC-2017 (Rel. 135, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 5) XX DE Pristimantis humboldti voucher NMP6V75538 recombination activating protein DE 1 (RAG1) gene, partial cds. XX KW . XX OS Pristimantis humboldti OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Anura; Neobatrachia; Hyloidea; Strabomantidae; Pristimantis. XX RN [1] RC Publication Status: Online-Only RP 1-622 RX PUBMED; 29187793. RA Lehr E., von May R., Moravec J., Cusi J.C.; RT "A new species of Phrynopus (Amphibia, Anura, Craugastoridae) from upper RT montane forests and high Andean grasslands of the Pui Pui Protected Forest RT in central Peru"; RL J. Anim. Genet. Zookeys(713):131-157(2017). XX RN [2] RP 1-622 RA von May R., Lehr E.; RT ; RL Submitted (17-APR-2017) to the INSDC. RL Ecology and Evolutionary Biology, University of Michigan, 2051 Ruthven RL Museums Building, 1109 Geddes Ave., Ann Arbor, MI 48109, USA XX DR MD5; 1831d13c62ebf42186b715c702421402. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..622 FT /organism="Pristimantis humboldti" FT /mol_type="genomic DNA" FT /country="Peru:Junin, Quebrada Tarhuish, left bank of FT Antuyo River, Shiusha, at night on lower vegetation (ca. 1 FT m), in upper cloud forest" FT /lat_lon="11.36 S 74.94 W" FT /specimen_voucher="NMP6V75538" FT /collected_by="E. Lehr & R. von May" FT /collection_date="14-May-2012" FT /db_xref="taxon:2058354" FT /altitude="3318m" FT gene <1..>622 FT /gene="RAG1" FT mRNA <1..>622 FT /gene="RAG1" FT /product="recombination activating protein 1" FT CDS <1..>622 FT /codon_start=1 FT /gene="RAG1" FT /product="recombination activating protein 1" FT /db_xref="GOA:A0A2H4W8G8" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR017907" FT /db_xref="InterPro:IPR018957" FT /db_xref="InterPro:IPR019485" FT /db_xref="InterPro:IPR024627" FT /db_xref="InterPro:IPR035714" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:A0A2H4W8G8" FT /protein_id="AUC63244.1" FT /translation="KFNNSSSEVYFPRNNAVEWKPHCXKCDVCSSSKNWGKRKSTLHQN FT CLXKKRKLNVEHKKKNKSGKMSPLWKKTRTLNQIRNKCKQIHLDSNLMVVDYPSDFTKS FT FTCQVCEHILSDPVQTSCKHLFCRICILKYFKIMGCYCPSCRHTCFPTDLAPPVKSFLN FT ILNSLVLKCAVTGCDEEILLGKYSQHIAKHKEIKGKDAYAPINK" XX SQ Sequence 622 BP; 201 A; 134 C; 119 G; 163 T; 5 other; aaattcaaca attcctccag tgaggtttat tttccccgta acaatgcggt ggagtggaag 60 cctcactgty ccaaatgtga tgtttgcagt tcctccaaaa attggggtaa gagaaagtca 120 acattgcacc aaaactgtct twtmaaaaag aggaaactca atgtggaaca taaaaagaaa 180 aacaaaagtg gaaagatgtc ccctctctgg aagaagacta ggaccctgaa tcaaatcagg 240 aacaagtgca aacaaatcca ccttgattcc aacttaatgg ttgttgacta tccttccgat 300 tttacgaagt cgttcacatg ccaggtgtgt gagcacatat tgtctgatcc agtgcaaacy 360 tcatgcaaac atttgttctg caggatttgc atcctcaaat atttcaagat tatgggttgc 420 tactgcccat cttgcagaca cacttgcttc ccaacggatc tggcaccacc cgtgaagtca 480 tttcttaaca ttttaaactc cttggtctta aagtgcgcag tgactggatg tgatgaggaa 540 atcctgctwg gaaaatactc ccaacatatt gctaaacata aagaaatcaa aggtaaagat 600 gcttatgccc ctatcaacaa ag 622 //