ID LC348702; SV 1; linear; genomic DNA; STD; INV; 460 BP. XX AC LC348702; XX DT 24-JUN-2018 (Rel. 137, Created) DT 19-AUG-2018 (Rel. 137, Last updated, Version 3) XX DE Asphondylia yushimai KORJeju558 mitochondrial COI gene for cytochrome DE oxidase subunit 1, partial cds. XX KW . XX OS Asphondylia yushimai OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Diptera; Nematocera; Sciaroidea; Cecidomyiidae; OC Asphondylia. OG Mitochondrion XX RN [1] RP 1-460 RA Uechi N., Tokuda M., Yukawa J., Kim W., Fujii T.; RT ; RL Submitted (16-DEC-2017) to the INSDC. RL Contact:Nami Uechi National Agriculture and Food Research Organization, RL Institute of Fruit Tree and Tea Science; 2-1 Fujimoto, Tsukuba, Ibaraki RL 305-8605, Japan URL :http://www.naro.affrc.go.jp/ XX RN [2] RC DOI:10.1007/s13355-018-0567-7 RA Uechi N., Kim W., Tokuda M., Fujii T., Kikuchi H., Kakizaki M., Iwasaki A., RA Paik J.-C., Yukawa J.; RT "Genetic and ecological differences between Asphondylia yushimai and the RT ivy gall midge, Asphondylia sp. (Diptera: Cecidomyiidae), with a new RT distribution record of the former from Hokkaido and South Korea"; RL Appl. Entomol. Zool. 53:363-371(2018). XX DR MD5; ccee8f4766d15533c5f9ba058d5de2b6. XX FH Key Location/Qualifiers FH FT source 1..460 FT /organism="Asphondylia yushimai" FT /organelle="mitochondrion" FT /host="Glycine max" FT /isolate="KORJeju558" FT /mol_type="genomic DNA" FT /country="South Korea:An-Deok-Myeon, Jeju Island" FT /isolation_source="pod gall of Glycine max" FT /collected_by="Yukawa, J et al." FT /collection_date="2005-10-18" FT /db_xref="taxon:196622" FT CDS <1..>460 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A2Z5X8K1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A2Z5X8K1" FT /protein_id="BBC28505.1" FT /translation="PPNMAFPRLNNMSFWLLPPSLTILLMSSIIENGTGTGWTIYPPLS FT SIIAHNSSSTDLSIFSLHIAGISSILGAINFITTIINMKNKFIKLNELSLFIWSILITT FT ILLLLSLPVLAGAITMLITDRNLNTSFFDPMGGGDPILYQHLFWFFGHP" XX SQ Sequence 460 BP; 152 A; 73 C; 44 G; 191 T; 0 other; accccctaat atagcattcc cacgattaaa taatataaga ttttgacttt tacctccatc 60 attaactatt ttattaataa gaagaattat tgaaaatgga acaggaactg gatgaactat 120 ttatcctcct ttatcttcta ttattgctca taatagaaga tcaacagatt tatcaatttt 180 ctctcttcat attgctggaa tttcttctat tttaggagct attaatttta ttactactat 240 tatcaatata aaaaataaat ttattaaact taatgaatta tcacttttta tttgatcaat 300 cttaattact actattcttt tacttttatc attaccagtt cttgcaggag ctattactat 360 attaattact gaccgaaatt taaatacttc attttttgat cctataggag gaggagatcc 420 aattctttat caacatttat tttgattttt tggacatcca 460 //