ID LN650145; SV 1; linear; genomic DNA; STD; PRO; 519 BP. XX AC LN650145; XX DT 18-OCT-2016 (Rel. 130, Created) DT 18-OCT-2016 (Rel. 130, Last updated, Version 1) XX DE Bradyrhizobium sp. Pear76 partial glnII gene for Glutamine synthetase DE isoform II, isolate Pear76 XX KW . XX OS Bradyrhizobium sp. Pear76 OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; OC Bradyrhizobiaceae; Bradyrhizobium; unclassified Bradyrhizobium. XX RN [1] RP 1-519 RA Beukes C.; RT ; RL Submitted (04-NOV-2014) to the INSDC. RL Department of Microbiology and Plant Pathology, University of Pretoria, RL Private Bag X20, Hatfield, 0028, SOUTH AFRICA. XX RN [2] RA Beukes C.W., Stepkowski T., Phalane F.L., Venter S.N., Le Roux M.M., RA Steenkamp E.T.; RT "Crotalarieae and Genisteae of the Great Escarpment in Mpumalanga are RT nodulated by novel Bradyrhizobium species with unique and diverse symbiotic RT loci"; RL Unpublished. XX DR MD5; 270294243e9248ea6bcd84dcc7ec0acc. XX FH Key Location/Qualifiers FH FT source 1..519 FT /organism="Bradyrhizobium sp. Pear76" FT /isolate="Pear76" FT /mol_type="genomic DNA" FT /country="South Africa" FT /isolation_source="Pearsonia obovata root nodules" FT /db_xref="taxon:1571201" FT CDS <1..>519 FT /codon_start=1 FT /transl_table=11 FT /gene="glnII" FT /product="Glutamine synthetase isoform II" FT /db_xref="GOA:A0A1E1JJR0" FT /db_xref="InterPro:IPR008146" FT /db_xref="InterPro:IPR008147" FT /db_xref="InterPro:IPR014746" FT /db_xref="InterPro:IPR027302" FT /db_xref="InterPro:IPR036651" FT /db_xref="UniProtKB/TrEMBL:A0A1E1JJR0" FT /protein_id="CEI71437.1" FT /translation="WGFDGSSTQQAEGHSSDCVLKPVACYPDAARENGVLVMCEVMMPD FT GKTPHVSNKRATVLDDEGAWFGFEQEYFFYKDGRPLGFPEAGYPAPQGPYYTGVGYSNV FT GSVARKIVEEHLNLCLAAGINHEGINAEVAKGQWEFQIFGKGSKTAADQMWMARYLMLR FT LTESYGIDIE" XX SQ Sequence 519 BP; 100 A; 168 C; 162 G; 89 T; 0 other; tggggctttg acggttcgtc cacccagcag gctgaaggcc acagctctga ctgcgtgctg 60 aagccggtcg cctgctatcc cgacgccgcg cgcgagaacg gcgtgctggt gatgtgcgaa 120 gtcatgatgc ccgacggcaa gacgccgcat gtctcgaaca agcgcgccac cgtgctggac 180 gacgagggcg cctggttcgg cttcgagcag gagtacttct tctacaagga cggccgtccg 240 ctcggcttcc cggaagccgg ttatcccgcg ccgcagggcc cgtactatac cggcgtcggc 300 tattcgaacg tcggcagcgt cgcccgcaag atcgtggaag agcacctcaa tctctgtctc 360 gccgccggca tcaaccacga aggcatcaac gccgaagtgg ccaagggcca gtgggaattc 420 cagatcttcg gcaagggctc caagaccgcc gctgaccaga tgtggatggc tcgctatctg 480 atgctgcgcc tcaccgagag ctacggcatc gacatcgaa 519 //