ID M18618; SV 1; linear; genomic DNA; STD; MUS; 162 BP. XX AC M18618; J02754; XX DT 16-JUL-1988 (Rel. 16, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 7) XX DE Mouse EGF-binding protein gene, exon 3, clone mGK-22. XX KW elongation growth factor-binding protein; KW epidermal growth factor binding protein; kallikrein. XX OS Mus musculus (house mouse) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; OC Murinae; Mus; Mus. XX RN [1] RP 1-162 RX PUBMED; 3036794. RA Evans B.A., Drinkwater C.C., Richards R.I.; RT "Mouse glandular kallikrein genes. Structure and partial sequence analysis RT of the kallikrein gene locus"; RL J Biol Chem 262(17):8027-8034(1987). XX DR MD5; 8c4f771493b29573df84104b88858442. DR Ensembl-Gn; ENSMUSG00000060177; mus_musculus. DR Ensembl-Gn; MGP_C57BL6NJ_G0032631; mus_musculus_c57bl6nj. DR Ensembl-Tr; ENSMUST00000077528; mus_musculus. DR Ensembl-Tr; MGP_C57BL6NJ_T0084045; mus_musculus_c57bl6nj. XX CC Draft entry and printed copy of sequence for [1] kindly provided by CC B.A.Evans, 20-JUL-1987. XX FH Key Location/Qualifiers FH FT source 1..162 FT /organism="Mus musculus" FT /sub_species="domesticus" FT /strain="BALB/c" FT /mol_type="genomic DNA" FT /tissue_type="liver" FT /db_xref="taxon:10090" FT intron <1..8 FT /note="EGF-binding protein intron B" FT CDS 9..162 FT /partial FT /codon_start=2 FT /number=3 FT /note="EGF-binding protein" FT /db_xref="GOA:P15948" FT /db_xref="InterPro:IPR001254" FT /db_xref="InterPro:IPR001314" FT /db_xref="InterPro:IPR009003" FT /db_xref="InterPro:IPR018114" FT /db_xref="InterPro:IPR033116" FT /db_xref="MGI:MGI:95291" FT /db_xref="UniProtKB/Swiss-Prot:P15948" FT /protein_id="AAA39362.1" FT /translation="KYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGAD FT LSNDLM" XX SQ Sequence 162 BP; 47 A; 48 C; 31 G; 36 T; 0 other; ccccacagca agtataatat ttggctgggc aaaaacaagc tattccaaga tgaaccctct 60 gctcagcacc gattggtcag caaaagcttc cctcatcctg acttcaacat gagcctcctc 120 caaagtgtac ctactggggc cgacttaagc aatgacctga tg 162 //