ID MW160335; SV 1; linear; genomic DNA; STD; INV; 213 BP. XX AC MW160335; XX DT 17-AUG-2021 (Rel. 144, Created) DT 17-AUG-2021 (Rel. 144, Last updated, Version 1) XX DE Areopaguristes nr. hummi USNM 1548225 histone 3 (H3) gene, partial cds. XX KW . XX OS Areopaguristes nr. hummi USNM 1548225 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Malacostraca; Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Anomura; OC Paguroidea; Diogenidae; Areopaguristes. XX RN [1] RC DOI: 10.11646/zootaxa.4999.4.1 RP 1-213 RA Craig C.W., Felder D.L.; RT "Molecular phylogenetic analysis of the Paguristes tortugae Schmitt, 1933 RT complex and selected other Paguroidea (Crustacea: Decapoda: Anomura)"; RL Zootaxa 4999(4):301-324(2021). XX RN [2] RP 1-213 RA Craig C.W.; RT ; RL Submitted (22-OCT-2020) to the INSDC. RL Biological Sciences, University of Louisiana, Lafayette, 410 E. St. Mary RL Blvd., Billeaud Hall, Room 108, Lafayette, LA 70503, USA XX DR MD5; cc3c48eafb77a84fe2ef5a37a23cfcc2. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..213 FT /organism="Areopaguristes nr. hummi USNM 1548225" FT /mol_type="genomic DNA" FT /specimen_voucher="ULLZ:15009" FT /specimen_voucher="USNM:1548225" FT /db_xref="taxon:2781312" FT gene <1..>213 FT /gene="H3" FT mRNA <1..>213 FT /gene="H3" FT /product="histone 3" FT CDS <1..>213 FT /codon_start=1 FT /gene="H3" FT /product="histone 3" FT /protein_id="QYO90321.1" FT /translation="RKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRL FT VREIAQDFKTDLRFQSSAVMALQEAS" XX SQ Sequence 213 BP; 48 A; 64 C; 59 G; 42 T; 0 other; agaaagtctg cccctgcaac aggaggtgtc aagaagcccc atcgttacag gcccggaact 60 gtggccctgc gtgagatccg tcgctaccag aagagcacag agctgctcat caggaagctg 120 cccttccaac gtctggtgcg tgagattgcc caggatttca agactgacct gcgtttccag 180 tcctcagccg tcatggcgct gcaggaagct tca 213 //