ID ON572249; SV 1; linear; genomic DNA; STD; INV; 235 BP. XX AC ON572249; XX DT 12-OCT-2022 (Rel. 144, Created) DT 13-OCT-2022 (Rel. 144, Last updated, Version 1) XX DE Diplopathes antarctica isolate NIWA38674 cytochrome c oxidase subunit I DE (cox1) gene, partial cds; mitochondrial. XX KW . XX OS Diplopathes antarctica OC Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Antipatharia; OC Schizopathidae; Diplopathes. OG Mitochondrion XX RN [1] RC Publication Status: Online-Only RP 1-235 RX PUBMED; 36101256. RA Opresko D.M., Stewart R., Voza T., Tracey D.I., Brugler M.R.; RT "New genus and species of black coral from the SW Pacific and Antarctica RT (Cnidaria: Anthozoa: Antipatharia: Schizopathidae)"; RL Zootaxa 5169(1):31-48(2022). XX RN [2] RP 1-235 RA Brugler M.R., Voza T.; RT ; RL Submitted (17-MAY-2022) to the INSDC. RL Department of Natural Sciences, University of South Carolina Beaufort, 801 RL Carteret Street, Beaufort, SC 29902, USA XX DR MD5; 779a3f01e19e54904234fc6dfc438a28. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..235 FT /organism="Diplopathes antarctica" FT /organelle="mitochondrion" FT /isolate="NIWA38674" FT /mol_type="genomic DNA" FT /specimen_voucher="USNM1491412" FT /db_xref="taxon:2983683" FT /type_material="paratype of Diplopathes antarctica" FT gene <1..>235 FT /gene="cox1" FT CDS <1..>235 FT /codon_start=2 FT /transl_table=4 FT /gene="cox1" FT /product="cytochrome c oxidase subunit I" FT /protein_id="UXX19930.1" FT /translation="TLYLVFGIGSGMVGTALSMLIRLELSAPGTMLGDDHLYNVIVTAH FT ALIMIFFLVMPVMIGGFGNWLVPLYIGAPDMAF" XX SQ Sequence 235 BP; 58 A; 39 C; 56 G; 82 T; 0 other; tacattatat ctagtatttg gaatagggtc tggtatggta ggtacagctt taagtatgtt 60 gataagatta gaactatctg ctcctggcac tatgttaggg gacgaccatc tttataatgt 120 aatagttaca gcgcatgccc ttattatgat tttcttctta gtcatgccag ttatgatagg 180 gggatttggg aattggctag tcccactata tatcggtgcg ccggatatgg ccttc 235 //