ID QXO86886; SV 1; linear; genomic DNA; STD; PLN; 132 BP. XX PA MZ169540.1 XX DT 23-JUL-2021 (Rel. 144, Created) DT 23-JUL-2021 (Rel. 144, Last updated, Version 1) XX DE Arabidopsis thaliana (thale cress) photosystem II protein N XX KW . XX OS Arabidopsis thaliana (thale cress) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. OG Plastid:chloroplast XX RN [1] RA Ouyang X.; RT "The complete chloroplast genome sequence of medicinal plant : Centipeda RT minima (Compositae)"; RL Unpublished. XX RN [2] RA Ouyang X.; RT ; RL Submitted (12-MAY-2021) to the INSDC. RL School of Forestry and Biotechnology, Zhejiang A&F University, Hangzhou RL Wusu, Hangzhou, Zhejiang 311300, China XX DR MD5; 0a2fcfe812f1d1017b1a7b3fe9e42f87. XX FH Key Location/Qualifiers FH FT source 1..132 FT /organism="Arabidopsis thaliana" FT /organelle="plastid:chloroplast" FT /mol_type="genomic DNA" FT /country="China:Hangzhou" FT /db_xref="taxon:3702" FT CDS complement(MZ169540.1:35059..35190) FT /codon_start=1 FT /transl_table=11 FT /gene="psbN" FT /product="photosystem II protein N" FT /protein_id="QXO86886.1" FT /translation="METATLVAIFISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD" XX SQ Sequence 132 BP; 37 A; 30 C; 26 G; 39 T; 0 other; atggaaacag caaccctagt cgccatcttt atatctggtt tacttgtaag ttttactggg 60 tacgccttat ataccgcttt tgggcaacct tctcaacaac taagagatcc attcgaggaa 120 catggggact aa 132 //