ID S82862; SV 1; linear; mRNA; STD; INV; 180 BP. XX AC S82862; XX DT 14-FEB-1997 (Rel. 50, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 6) XX DE Aedes aegypti defensin A isoform 3 (DefA3) mRNA, partial cds. XX KW . XX OS Aedes aegypti (yellow fever mosquito) OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Diptera; Nematocera; Culicoidea; Culicidae; OC Culicinae; Aedini; Aedes; Stegomyia. XX RN [1] RC GenBank staff at the National Library of Medicine created this entry [NCBI RC gibbsq 179335] from the original journal article. RP 1-180 RX DOI; 10.1016/0965-1748(95)00108-5. RX PUBMED; 8814787. RA Cho W.L., Fu Y.C., Chen C.C., Ho C.M.; RT "Cloning and characterization of cDNAs encoding the antibacterial peptide, RT defensin A, from the mosquito, Aedes aegypti"; RL Insect Biochem. Mol. Biol. 26(4):395-402(1996). XX DR MD5; 2ca272815b01b82bf65ec0e2ec201d2a. XX FH Key Location/Qualifiers FH FT source 1..180 FT /organism="Aedes aegypti" FT /strain="Kaoshiung" FT /mol_type="mRNA" FT /db_xref="taxon:7159" FT gene 1..>180 FT /gene="DefA3" FT CDS 71..>180 FT /codon_start=1 FT /gene="DefA3" FT /product="defensin A isoform 3" FT /note="antibacterial peptide; precursor; AaDefA3" FT /db_xref="GOA:P91793" FT /db_xref="InterPro:IPR001542" FT /db_xref="InterPro:IPR036574" FT /db_xref="UniProtKB/Swiss-Prot:P91793" FT /protein_id="AAB46809.2" FT /translation="MQSLTVICFLALCTGAITSAYPQEPVLADEARPFANS" XX SQ Sequence 180 BP; 40 A; 59 C; 37 G; 44 T; 0 other; gatcattcaa ttccacaagc tcgttcaaga gatatcagct ctcttccaat cgatcccgaa 60 aggaccaacc atgcagtccc tcactgtcat ttgtttcctg gctctgtgca ccggggccat 120 tactagtgcc tacccacagg aaccggtgct ggcggacgaa gctcgccctt ttgccaactc 180 //