ID   SIT99353; SV 1; linear; genomic DNA; STD; PRO; 546 BP.
XX
PA   LT708304.1
XX
PR   Project:PRJEB15187;
XX
DT   19-JAN-2017 (Rel. 131, Created)
DT   25-MAY-2020 (Rel. 144, Last updated, Version 6)
XX
DE   Mycobacterium tuberculosis variant bovis AF2122/97 adenylate kinase adk
DE   (atp-amp transphosphorylase)
XX
KW   .
XX
OS   Mycobacterium tuberculosis variant bovis AF2122/97
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium tuberculosis complex.
XX
RN   [1]
RA   Malone K.M.;
RT   ;
RL   Submitted (06-DEC-2016) to the INSDC.
RL   School of Veterinary Medicine, Tuberculosis Molecular Microbiology Research
RL   Group, University College Dublin, Tuberculosis Molecular Microbiology
RL   Research Group, School of Veterinary Medicine, University College Dublin,
RL   D4, Ireland
XX
RN   [2]
RA   Malone M K., Farrell D., Malone K.;
RT   ;
RL   Submitted (15-APR-2020) to the INSDC.
RL   School of Veterinary Medicine, Tuberculosis Molecular Microbiology Research
RL   Group, University College Dublin, Tuberculosis Molecular Microbiology
RL   Research Group, School of Veterinary Medicine,, University College Dublin,
RL   D4, Ireland
XX
DR   MD5; 1b68dafd3700dc2ea2c1a7e3dd811052.
DR   BioSample; SAMEA20450668.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Mycobacterium tuberculosis variant bovis
FT                   AF2122/97"
FT                   /chromosome="Mycobacterium_bovis_AF212297"
FT                   /isolate="AF2122/97"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="Mycobacterium bovis subsp. bovis strain
FT                   AF2122/97. This strain is a fully virulent strain that was
FT                   isolated in 1997 in the UK from a cow suffering necrotic
FT                   lesions in lung and bronchomediastinal lymph nodes. The
FT                   strain was also reported to infect and persist in badgers
FT                   that are considered to be a significant source of bovine
FT                   infection."
FT                   /db_xref="taxon:233413"
FT   CDS             LT708304.1:827944..828489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BQ2027_MB0754"
FT                   /product="adenylate kinase adk (atp-amp
FT                   transphosphorylase)"
FT                   /note="Mb0754, adk, len: 181 aa. Equivalent to Rv0733, len:
FT                   181 aa, from Mycobacterium tuberculosis strain H37Rv,
FT                   (100.0% identity in 181 aa overlap). Probable adk,
FT                   adenylate kinase (ATP-AMP transphosphorylase) (EC 2.7.4.3),
FT                   equivalent to Z98756|MLCB24 92_28 probable adenylate kinase
FT                   from Mycobacterium leprae (181 aa), FASTA scores: opt: 978,
FT                   E(): 0, (83.6% identity in 177 aa overlap); and
FT                   AAF86323.1|AF271342 putative adenylate kinase from
FT                   Mycobacterium marinum (124 aa) (N-terminus shorter). Also
FT                   highly similar to others e.g. P43414|KAD_STRCO ADENYLATE
FT                   KINASE from Streptomyces coelicolor (217 aa), FASTA score:
FT                   (43.0% identity in 186 aa overlap); etc. Contains PS00113
FT                   Adenylate kinase signature. BELONGS TO THE ADENYLATE KINASE
FT                   FAMILY. Protein product from Mb0754 detected using shotgun
FT                   mass spectrometry and SWATH mass spectrometry. Mb0754 found
FT                   to be expressed during exponential growth in Sauton's
FT                   minimal media by RNA-sequencing."
FT                   /db_xref="GOA:P69439"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69439"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="SIT99353.1"
FT                   /translation="MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL
FT                   GVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRG
FT                   TDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVD
FT                   AVGTMDEVFARALRALGK"
XX
SQ   Sequence 546 BP; 108 A; 160 C; 188 G; 90 T; 0 other;
     gtgagagttt tgttgctggg accgcccggg gcgggcaagg ggacgcaggc ggtgaagctc        60
     gccgagaagc tcgggatccc gcagatctcc accggcgaac tcttccggcg caacatcgaa       120
     gagggcacca agctcggcgt ggaagccaaa cgctacttgg atgccggtga cttggtgccg       180
     tccgacttga ccaatgaact cgtcgacgac cggctgaaca atccggacgc ggccaacgga       240
     ttcatcttgg atggctatcc acgctcggtc gagcaggcca aggcgcttca cgagatgctc       300
     gaacgccggg ggaccgacat cgacgcggtg ctggagtttc gtgtgtccga ggaggtgttg       360
     ttggagcgac tcaaggggcg tggccgcgcc gacgacaccg acgacgtcat cctcaaccgg       420
     atgaaggtct accgcgacga gaccgcgccg ctgctggagt actaccgcga ccaattgaag       480
     accgtcgacg ccgtcggcac catggacgag gtgttcgccc gtgcgttgcg ggctctggga       540
     aagtag                                                                  546
//