A0A014QYZ2

Kazal-like domain-containing protein

UniProtKB/TrEMBL protein

AlphaFold structure prediction

The protein structure below has been predicted by DeepMind with AlphaFold (Jumper, J et al. 2021). For more information and additional features, please visit this sequence's page at AlphaFold DB.

Information
Model confidence
  •   Very High (pLDDT > 90)
  •   Confident (90 > pLDDT > 70)
  •   Low (70 > pLDDT > 50)
  •   Very Low (pLDDT < 50)
Protein domains
1106102030405060708090100
50100MFHPLLVLLSTAALLQVGLATPLSVRDVAAEPGNVTSDSRKYQIPDRHSEASPLRFVVEDAEAGRNCFCTMEYAPVCAGNKVYSNKCKAMCAGETEHSLGGCNQSS
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use.