A0A1G4MKZ9

Biogenesis of lysosome-related organelles complex 1 subunit BLI1

UniProtKB/TrEMBL protein

Structure prediction

There is no structural model associated to A0A1G4MKZ9.

Protein domains
1110102030405060708090100110
50100MKEKVLKQEIERCAEHVQEIVDLESAKAISEFQSKADENYQWLEELKTRYSMRNDNENDIRQLRSRHKEKIDALEEDVNYFEKLLDEMEEFVTELDVKRKLANKRQSRSK
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use.