P16654

RNA silencing suppressor

UniProtKB/Swiss-Prot protein
Short nameVSR_PVSP
Length93 amino acids
SpeciesPotato virus S (strain Peruvian)
Function
Suppressor of viral-induced RNA silencing. The potential mechanism of action is based on sequestering siRNAs (By similarity)
Family membership
Entry matches to this protein
193102030405060708090
20406080MKAERLEMLLLCVYRLGYILPVDVCIKIISVAQVSVQGRSTYSCKRRARSIGRCWRCYRVYPPVCNSKCDNRTCRPGISPNFKVVTFIRGWSN

InterPro GO terms

cellular component

  • None
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use.