A0A023EBD3

Kazal-like domain-containing protein

UniProtKB/TrEMBL protein
Short nameA0A023EBD3_AEDAL
Length71 amino acids
SpeciesAedes albopictus (Asian tiger mosquito)
Family membership
None predicted
Entry matches to this protein
171510152025303540455055606570
204060MLILISVGSIVIRGSSGCLCGSEVIPVCGTDGVTYPNKCHLGCQQLLTGVQMVKVGNCQGDPDRPYGDNVL

InterPro GO terms

biological process

  • None

cellular component

  • None
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use.