A0A088DB27

Potassium channel blocker pMeKTx2-2

UniProtKB/TrEMBL protein
Short nameA0A088DB27_MESEU
Length56 amino acids
SpeciesMesobuthus eupeus (Lesser Asian scorpion)
Family membership
Entry matches to this protein
156510152025303540455055
2040MSRLFTLVLIVLAMNVMMAIISDPVVEAVGCEECPKYCKGKNAVPTCDGGVCNCNA

InterPro GO terms

biological process

  • None
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use.