1ne5

Solution Structure of HERG Specific Scorpion Toxin CnErg1

PDB structure
Accession
1ne5
Experiment typeNMR
ChainsA
Released1 April 2003

Chain A ( Q86QT3)

Domains in the chain
142510152025303540
10203040DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
PDB: Chain A

References

1. Solution structure of CnErg1 (Ergtoxin), a HERG specific scorpion toxin Torres, A.M., Bansal, P., Alewood, P.F., Bursill, J.A., Kuchel, P.W., Vandenberg, J.I. FEBS Lett. 539, 138-142, (2003). View articlePMID: 12650941

2. A toxin to nervous, cardiac, and endocrine ERG K+ channels isolated from Centruroides noxius scorpion venom. Gurrola, G.B., Rosati, B., Rocchetti, M., Pimienta, G., Zaza, A., Arcangeli, A., Olivotto, M., Possani, L.D., Wanke, E. FASEB J. 13, 953-962, (1999).

3. Disulfide bridges of ergtoxin, a member of a new sub-family of peptide blockers of the ether-a-go-go-related K+ channel Scaloni, A., Bottiglieri, C., Ferrara, L., Corona, M., Gurrola, G.B., Batista, C., Wanke, E., Possani, L.D. FEBS Lett. 479, 156-157, (2000). View article

This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use.