Hemoglobin subunit alpha-A in PDB entry 1a4f ‹ PDBe

Chain: A
Length: 141 amino acids
Theoretical weight: 15.36 KDa
Source organism: Anser indicus
UniProt:

Canonical: P01990 (Residues: 2-142; Coverage: 99%)

Gene name: HBAA
FASTA Sequence


    >pdb|1a4f|A

VLSAADKTNVKGVFSKISGHAEEYGAETLERMFTAYPQTKTYFPHFDLQHGSAQIKAHGKKVVAALVEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVVAIHHPSALTAEVHASLDKFLCAVGTVLTAKYR

1a4f:A

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.