Large ribosomal subunit protein eL30 in PDB entry 1cn7 ‹ PDBe

Chain: A
Length: 104 amino acids
Theoretical weight: 11.3 KDa
Source organism: Saccharomyces cerevisiae
Expression system: Escherichia coli
UniProt:

Canonical: P14120 (Residues: 2-105; Coverage: 99%)

Gene names: RPL30, RPL32, YGL030W
FASTA Sequence


    >pdb|1cn7|A

APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA

1cn7:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.