Legume lectin domain-containing protein in PDB entry 1dzq ‹ PDBe

Chains: A, B, C, D
Length: 242 amino acids
Theoretical weight: 26.09 KDa
Source organism: Ulex europaeus
UniProt:

Canonical: Q9FVF8 (Residues: 1-242; Coverage: 94%)

FASTA Sequence


    >pdb|1dzq|A B C D

NLSDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSKPTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNLEANN

PDBe-KB: UniProt Coverage View: Q9FVF8

Loading Protvista...

1dzq:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.