Membrane-bound lytic murein transglycosylase D in PDB entry 1e0g ‹ PDBe

Chain: A
Length: 48 amino acids
Theoretical weight: 5.44 KDa
Source organism: Escherichia coli
Expression system: Not provided
UniProt:

Canonical: P0AEZ7 (Residues: 398-445; Coverage: 11%)

Gene names: JW5018, b0211, dniR, mltD, yafG
FASTA Sequence


    >pdb|1e0g|A

DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK

1e0g:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.