FMN-binding protein in PDB entry 1flm ‹ PDBe

Chains: A, B
Length: 122 amino acids
Theoretical weight: 13.15 KDa
Source organism: Desulfovibrio vulgaris str. 'Miyazaki F'
Expression system: Escherichia coli
UniProt:

Canonical: Q46604 (Residues: 1-122; Coverage: 100%)

Gene name: DvMF_2023
FASTA Sequence


    >pdb|1flm|A B

MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTL

PDBe-KB: UniProt Coverage View: Q46604

Loading Protvista...

1flm:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.