› › Early growth response protein 1

Early growth response protein 1 in PDB entry 1g2d, assembly 1, front view.
Early growth response protein 1 in PDB entry 1g2d, assembly 1, side view.
Early growth response protein 1 in PDB entry 1g2d, assembly 1, top view.
Chains: C, F
Length: 90 amino acids
Theoretical weight: 10.71 KDa
Source organism: Mus musculus
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P08046 (Residues: 333-421; Coverage: 17%)
Gene names: Egr-1, Egr1, Krox-24
FASTA Sequence
>pdb|1g2d|C F
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGLNQHIRTHTGEKPFACDICGRKFATLHTRDRHTKIHLRQKD
PDBe-KB: UniProt Coverage View: P08046  
Loading Protvista...
Loading...
 
 
  1g2d: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins