Negative modulator of initiation of replication in PDB entry 1j3e ‹ PDBe

Chain: A
Length: 115 amino acids
Theoretical weight: 12.98 KDa
Source organism: Escherichia coli
Expression system: Escherichia coli
UniProt:

Canonical: P0AFY8 (Residues: 71-181; Coverage: 61%)

Gene names: JW0674, b0687, seqA
FASTA Sequence


    >pdb|1j3e|A

PLGSAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI

PDBe-KB: UniProt Coverage View: P0AFY8

Loading Protvista...

1j3e:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.