› › Cytochrome b-c1 complex subunit 7

Cytochrome b-c1 complex subunit 7 in PDB entry 1l0l, assembly 1, front view.
Cytochrome b-c1 complex subunit 7 in PDB entry 1l0l, assembly 1, side view.
Cytochrome b-c1 complex subunit 7 in PDB entry 1l0l, assembly 1, top view.
Chain: F
Length: 110 amino acids
Theoretical weight: 13.37 KDa
Source organism: Bos taurus
UniProt:
  • Canonical: P00129 (Residues: 2-111; Coverage: 99%)
Gene name: UQCRB
FASTA Sequence
>pdb|1l0l|F
AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK
PDBe-KB: UniProt Coverage View: P00129  
Loading...
 
 
  1l0l:F 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins