Multidrug resistance operon repressor in PDB entry 1lnw ‹ PDBe

Chains: A, B, C, D, E, F, G, H
Length: 147 amino acids
Theoretical weight: 17.22 KDa
Source organism: Pseudomonas aeruginosa
Expression system: Escherichia coli
UniProt:

Canonical: P52003 (Residues: 1-147; Coverage: 100%)

Gene names: PA0424, mexR
FASTA Sequence


    >pdb|1lnw|A B C D E F G H

MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQPLEDI

1lnw:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.