Cytochrome b5 in PDB entry 1lqx ‹ PDBe

Chain: A
Length: 82 amino acids
Theoretical weight: 9.51 KDa
Source organism: Bos taurus
Expression system: Escherichia coli
UniProt:

Canonical: P00171 (Residues: 8-89; Coverage: 61%)

Gene names: CYB5, CYB5A
FASTA Sequence


    >pdb|1lqx|A

AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEELREQAGGDATENFEDVGHSTDARELSKTFIIGELHPDDR

1lqx:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.