Dihydroneopterin aldolase in PDB entry 1rsi ‹ PDBe

Chain: A
Length: 121 amino acids
Theoretical weight: 13.77 KDa
Source organism: Staphylococcus aureus
Expression system: Escherichia coli
UniProt:

Canonical: P56740 (Residues: 1-121; Coverage: 100%)

Gene name: folB
FASTA Sequence


    >pdb|1rsi|A

MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLSEAGRTDNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERIANRINSQYNRVMETKVRITKENPPIPGHYDGVGIEIVRENK

1rsi:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.